Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L0VVC5

Protein Details
Accession A0A0L0VVC5    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
79-100AFHANSWKPFCRKKKPKGQNAKHydrophilic
NLS Segment(s)
PositionSequence
90-100RKKKPKGQNAK
Subcellular Location(s) mito 19.5, cyto_mito 12, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036914  MGS-like_dom_sf  
Amino Acid Sequences MPKDYVGVKGPQFSFSRLASADPVLGVGMSLRSEKSVIFSIGVYTDKLEMLPLVQRLHRLRYTIYGTTGTNDFNLKNMAFHANSWKPFCRKKKPKGQNAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.28
3 0.29
4 0.23
5 0.23
6 0.2
7 0.19
8 0.16
9 0.12
10 0.12
11 0.09
12 0.08
13 0.06
14 0.04
15 0.04
16 0.05
17 0.05
18 0.05
19 0.06
20 0.07
21 0.07
22 0.09
23 0.11
24 0.11
25 0.11
26 0.1
27 0.1
28 0.11
29 0.12
30 0.09
31 0.07
32 0.07
33 0.07
34 0.07
35 0.06
36 0.05
37 0.05
38 0.06
39 0.08
40 0.09
41 0.09
42 0.15
43 0.17
44 0.21
45 0.22
46 0.22
47 0.21
48 0.25
49 0.29
50 0.25
51 0.26
52 0.23
53 0.21
54 0.22
55 0.22
56 0.17
57 0.14
58 0.14
59 0.12
60 0.11
61 0.14
62 0.12
63 0.11
64 0.13
65 0.16
66 0.16
67 0.17
68 0.25
69 0.28
70 0.33
71 0.37
72 0.42
73 0.45
74 0.55
75 0.64
76 0.66
77 0.71
78 0.77
79 0.84
80 0.88