Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0UIY2

Protein Details
Accession A0A0L0UIY2   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
65-90SNSLREQERKSRNRTRCRSATQRSLSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito 9.5, cyto_mito 7, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MGAGSKSALLKSLMSSNTYFKKAAGGMRSPLVKSLSLSLSNSNLNGDTSHLSNPMAIANAIVSRSNSLREQERKSRNRTRCRSATQRSLSASSEISEGYELGLFS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.22
3 0.26
4 0.29
5 0.31
6 0.3
7 0.24
8 0.26
9 0.26
10 0.29
11 0.28
12 0.27
13 0.26
14 0.29
15 0.31
16 0.28
17 0.28
18 0.24
19 0.2
20 0.17
21 0.18
22 0.17
23 0.17
24 0.18
25 0.16
26 0.17
27 0.17
28 0.16
29 0.14
30 0.11
31 0.1
32 0.09
33 0.09
34 0.08
35 0.09
36 0.09
37 0.09
38 0.09
39 0.08
40 0.08
41 0.07
42 0.07
43 0.05
44 0.05
45 0.04
46 0.05
47 0.05
48 0.05
49 0.05
50 0.07
51 0.07
52 0.1
53 0.11
54 0.13
55 0.21
56 0.27
57 0.34
58 0.42
59 0.52
60 0.57
61 0.65
62 0.73
63 0.75
64 0.8
65 0.82
66 0.81
67 0.8
68 0.81
69 0.83
70 0.81
71 0.82
72 0.77
73 0.74
74 0.68
75 0.62
76 0.55
77 0.46
78 0.38
79 0.29
80 0.23
81 0.18
82 0.15
83 0.12
84 0.1
85 0.09