Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L0VX75

Protein Details
Accession A0A0L0VX75    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
37-59HEGCLRPTDRPRRPANRSRRFYQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019711  ATP_synth_F0_suH  
Gene Ontology GO:0000276  C:mitochondrial proton-transporting ATP synthase complex, coupling factor F(o)  
GO:0015986  P:proton motive force-driven ATP synthesis  
Pfam View protein in Pfam  
PF10775  ATP_sub_h  
Amino Acid Sequences MISGGGSTELYAQQRIYVEAGRVRSEAKPLKAKTDAHEGCLRPTDRPRRPANRSRRFYQGNSASYRSKMSSITRKTTQAARRMTIAFPLRRTFVSSSSIKKDFVQELYLRELKSYKPSTQSLQGLQTQVRDFTMPAAPAAPEVPSAQDIAQEMQSWDSASLVNNQAPSSDTAEVDVNGQSADEFLAFLERDHPPPAAH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.18
3 0.18
4 0.17
5 0.19
6 0.22
7 0.24
8 0.24
9 0.24
10 0.25
11 0.24
12 0.31
13 0.34
14 0.37
15 0.44
16 0.43
17 0.49
18 0.52
19 0.53
20 0.48
21 0.53
22 0.47
23 0.42
24 0.48
25 0.42
26 0.39
27 0.43
28 0.4
29 0.33
30 0.42
31 0.48
32 0.49
33 0.56
34 0.64
35 0.66
36 0.75
37 0.8
38 0.82
39 0.82
40 0.81
41 0.76
42 0.76
43 0.71
44 0.65
45 0.64
46 0.61
47 0.55
48 0.53
49 0.53
50 0.45
51 0.41
52 0.4
53 0.31
54 0.24
55 0.23
56 0.25
57 0.31
58 0.35
59 0.4
60 0.41
61 0.42
62 0.43
63 0.48
64 0.48
65 0.46
66 0.44
67 0.39
68 0.39
69 0.38
70 0.36
71 0.34
72 0.34
73 0.28
74 0.27
75 0.27
76 0.25
77 0.24
78 0.27
79 0.23
80 0.19
81 0.21
82 0.21
83 0.24
84 0.27
85 0.28
86 0.26
87 0.25
88 0.26
89 0.22
90 0.21
91 0.21
92 0.17
93 0.18
94 0.22
95 0.23
96 0.2
97 0.19
98 0.19
99 0.17
100 0.23
101 0.25
102 0.23
103 0.25
104 0.28
105 0.3
106 0.35
107 0.37
108 0.31
109 0.31
110 0.31
111 0.28
112 0.26
113 0.26
114 0.21
115 0.19
116 0.17
117 0.14
118 0.11
119 0.12
120 0.14
121 0.11
122 0.11
123 0.11
124 0.1
125 0.1
126 0.11
127 0.08
128 0.07
129 0.07
130 0.08
131 0.08
132 0.09
133 0.09
134 0.09
135 0.1
136 0.11
137 0.11
138 0.11
139 0.11
140 0.11
141 0.11
142 0.1
143 0.09
144 0.08
145 0.08
146 0.08
147 0.12
148 0.14
149 0.16
150 0.16
151 0.16
152 0.16
153 0.17
154 0.18
155 0.18
156 0.17
157 0.15
158 0.16
159 0.17
160 0.17
161 0.17
162 0.15
163 0.11
164 0.09
165 0.09
166 0.07
167 0.06
168 0.07
169 0.05
170 0.05
171 0.05
172 0.08
173 0.08
174 0.09
175 0.13
176 0.15
177 0.18
178 0.2