Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0UV42

Protein Details
Accession A0A0L0UV42   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
204-231MEDGRPSTPPRRQRRRMNSKVGRHQIGPHydrophilic
NLS Segment(s)
PositionSequence
214-219RRQRRR
Subcellular Location(s) nucl 12.5, mito 12, cyto_nucl 8
Family & Domain DBs
Amino Acid Sequences MPASLSVARATATLPRHWSKPLSAGQALKSDPRISKKQQAANKTRLILQTYLKSGVEPSPEVLDSLDPTNLSYDGTVSSNGSIESLKVTSVASDERRRLVRKQARRQSIVPSFFEPPNHTSKSPAPSSGEPVALTTAALTQHDHPAAAFLAPPSRAVRRAISFAGTRPPPPKIRIIKPKPECLDDHSNPSSRDPFYYDKVLDGMEDGRPSTPPRRQRRRMNSKVGRHQIGPQVQSDQRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.31
3 0.33
4 0.37
5 0.39
6 0.36
7 0.41
8 0.43
9 0.43
10 0.44
11 0.45
12 0.44
13 0.45
14 0.43
15 0.39
16 0.35
17 0.34
18 0.34
19 0.38
20 0.43
21 0.45
22 0.53
23 0.58
24 0.63
25 0.65
26 0.7
27 0.72
28 0.71
29 0.71
30 0.63
31 0.59
32 0.54
33 0.51
34 0.44
35 0.39
36 0.36
37 0.33
38 0.34
39 0.29
40 0.26
41 0.24
42 0.23
43 0.22
44 0.18
45 0.16
46 0.16
47 0.16
48 0.16
49 0.15
50 0.13
51 0.11
52 0.12
53 0.11
54 0.09
55 0.09
56 0.1
57 0.1
58 0.09
59 0.08
60 0.07
61 0.07
62 0.08
63 0.08
64 0.08
65 0.08
66 0.08
67 0.08
68 0.08
69 0.07
70 0.06
71 0.07
72 0.06
73 0.06
74 0.06
75 0.06
76 0.06
77 0.07
78 0.1
79 0.14
80 0.18
81 0.19
82 0.23
83 0.28
84 0.3
85 0.32
86 0.4
87 0.45
88 0.51
89 0.6
90 0.66
91 0.69
92 0.7
93 0.69
94 0.67
95 0.65
96 0.58
97 0.49
98 0.42
99 0.38
100 0.34
101 0.34
102 0.28
103 0.23
104 0.25
105 0.26
106 0.23
107 0.23
108 0.26
109 0.3
110 0.28
111 0.27
112 0.25
113 0.23
114 0.28
115 0.26
116 0.23
117 0.18
118 0.17
119 0.15
120 0.12
121 0.11
122 0.06
123 0.06
124 0.05
125 0.06
126 0.07
127 0.07
128 0.1
129 0.11
130 0.11
131 0.09
132 0.1
133 0.1
134 0.09
135 0.08
136 0.06
137 0.08
138 0.08
139 0.1
140 0.11
141 0.13
142 0.15
143 0.17
144 0.21
145 0.21
146 0.24
147 0.23
148 0.24
149 0.23
150 0.22
151 0.27
152 0.24
153 0.26
154 0.25
155 0.3
156 0.31
157 0.33
158 0.41
159 0.42
160 0.51
161 0.59
162 0.65
163 0.7
164 0.72
165 0.78
166 0.72
167 0.68
168 0.6
169 0.57
170 0.58
171 0.5
172 0.51
173 0.46
174 0.46
175 0.44
176 0.45
177 0.42
178 0.33
179 0.33
180 0.3
181 0.31
182 0.31
183 0.36
184 0.32
185 0.29
186 0.28
187 0.27
188 0.22
189 0.18
190 0.16
191 0.12
192 0.13
193 0.12
194 0.12
195 0.14
196 0.18
197 0.25
198 0.32
199 0.4
200 0.5
201 0.61
202 0.7
203 0.8
204 0.87
205 0.9
206 0.92
207 0.93
208 0.92
209 0.92
210 0.93
211 0.91
212 0.84
213 0.75
214 0.71
215 0.69
216 0.66
217 0.58
218 0.49
219 0.47