Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0VXQ6

Protein Details
Accession A0A0L0VXQ6    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
283-341GTSCCAPKPKQVKQKQPSCRKPAASRKQPNSNPTNKHRYAKPKPSRRNHKQIPEEDDDEHydrophilic
NLS Segment(s)
PositionSequence
302-331RKPAASRKQPNSNPTNKHRYAKPKPSRRNH
Subcellular Location(s) nucl 15, mito 9, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013083  Znf_RING/FYVE/PHD  
Amino Acid Sequences MTVAKTKKPMFPRSVGNRLEIKLKVLRKMMTTLPWSQYPLKVLFFEESAYRLWLDQGKPPKQGTKQASSTMIITPGSSTHPIEVAFRPEGVDGMRKDRHDIPSSPDDQRKPIDVHDEEAVLEDYEKIELIKKWCNNDLQCSLCGQSIVIEEHLSYVNCRAPDCFMSTHLLCLSKHFLNISPTDDSPAVTIGDDPQLSLPRVLPDRGRCPECSIDLRWGELVKGCYRRMPKNCRKAQISDTDEDEDADDHYTDGQEELRLPNMSDYGNTSMTEDEDEPNTRGSGTSCCAPKPKQVKQKQPSCRKPAASRKQPNSNPTNKHRYAKPKPSRRNHKQIPEEDDDEPEQDFLKLMEELQVSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.69
3 0.65
4 0.61
5 0.56
6 0.56
7 0.47
8 0.43
9 0.41
10 0.43
11 0.44
12 0.44
13 0.45
14 0.41
15 0.44
16 0.44
17 0.43
18 0.43
19 0.42
20 0.41
21 0.41
22 0.42
23 0.41
24 0.4
25 0.37
26 0.36
27 0.32
28 0.29
29 0.29
30 0.26
31 0.23
32 0.22
33 0.18
34 0.16
35 0.15
36 0.15
37 0.13
38 0.12
39 0.14
40 0.19
41 0.2
42 0.25
43 0.34
44 0.38
45 0.44
46 0.47
47 0.52
48 0.51
49 0.59
50 0.59
51 0.58
52 0.57
53 0.56
54 0.56
55 0.49
56 0.45
57 0.37
58 0.32
59 0.23
60 0.18
61 0.14
62 0.12
63 0.14
64 0.15
65 0.14
66 0.13
67 0.14
68 0.14
69 0.17
70 0.18
71 0.2
72 0.18
73 0.17
74 0.18
75 0.16
76 0.17
77 0.15
78 0.19
79 0.15
80 0.21
81 0.25
82 0.25
83 0.29
84 0.34
85 0.39
86 0.39
87 0.39
88 0.39
89 0.43
90 0.47
91 0.48
92 0.49
93 0.44
94 0.43
95 0.43
96 0.4
97 0.34
98 0.31
99 0.34
100 0.29
101 0.29
102 0.27
103 0.25
104 0.21
105 0.2
106 0.19
107 0.1
108 0.09
109 0.07
110 0.06
111 0.06
112 0.06
113 0.05
114 0.07
115 0.1
116 0.14
117 0.2
118 0.23
119 0.27
120 0.31
121 0.37
122 0.35
123 0.39
124 0.4
125 0.35
126 0.33
127 0.3
128 0.28
129 0.21
130 0.2
131 0.14
132 0.1
133 0.09
134 0.1
135 0.09
136 0.08
137 0.07
138 0.08
139 0.1
140 0.08
141 0.07
142 0.08
143 0.1
144 0.1
145 0.11
146 0.1
147 0.11
148 0.13
149 0.15
150 0.14
151 0.13
152 0.17
153 0.17
154 0.17
155 0.16
156 0.17
157 0.14
158 0.15
159 0.18
160 0.14
161 0.15
162 0.15
163 0.15
164 0.16
165 0.17
166 0.18
167 0.16
168 0.15
169 0.17
170 0.16
171 0.14
172 0.12
173 0.12
174 0.09
175 0.07
176 0.07
177 0.06
178 0.07
179 0.07
180 0.07
181 0.07
182 0.09
183 0.1
184 0.1
185 0.1
186 0.11
187 0.13
188 0.14
189 0.17
190 0.2
191 0.27
192 0.31
193 0.33
194 0.32
195 0.34
196 0.35
197 0.35
198 0.34
199 0.28
200 0.29
201 0.27
202 0.26
203 0.23
204 0.21
205 0.18
206 0.17
207 0.18
208 0.17
209 0.2
210 0.2
211 0.25
212 0.3
213 0.39
214 0.45
215 0.54
216 0.59
217 0.66
218 0.73
219 0.76
220 0.74
221 0.71
222 0.67
223 0.66
224 0.6
225 0.52
226 0.47
227 0.42
228 0.37
229 0.32
230 0.27
231 0.17
232 0.13
233 0.11
234 0.09
235 0.06
236 0.07
237 0.07
238 0.06
239 0.07
240 0.07
241 0.06
242 0.08
243 0.09
244 0.12
245 0.12
246 0.12
247 0.12
248 0.13
249 0.13
250 0.12
251 0.14
252 0.15
253 0.15
254 0.15
255 0.15
256 0.14
257 0.14
258 0.16
259 0.14
260 0.12
261 0.14
262 0.16
263 0.16
264 0.17
265 0.16
266 0.14
267 0.14
268 0.13
269 0.14
270 0.14
271 0.19
272 0.2
273 0.22
274 0.29
275 0.31
276 0.39
277 0.46
278 0.53
279 0.59
280 0.67
281 0.76
282 0.79
283 0.87
284 0.89
285 0.9
286 0.9
287 0.88
288 0.87
289 0.84
290 0.84
291 0.85
292 0.85
293 0.85
294 0.85
295 0.85
296 0.87
297 0.86
298 0.85
299 0.83
300 0.82
301 0.8
302 0.78
303 0.8
304 0.76
305 0.76
306 0.75
307 0.77
308 0.78
309 0.81
310 0.82
311 0.83
312 0.87
313 0.91
314 0.94
315 0.94
316 0.94
317 0.93
318 0.93
319 0.92
320 0.9
321 0.87
322 0.83
323 0.77
324 0.67
325 0.61
326 0.51
327 0.42
328 0.34
329 0.26
330 0.2
331 0.15
332 0.14
333 0.1
334 0.11
335 0.1
336 0.1
337 0.15