Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0VY09

Protein Details
Accession A0A0L0VY09    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MFCHFRKKLRTKSHRQKRLVARKKSNPAVAHydrophilic
NLS Segment(s)
PositionSequence
6-25RKKLRTKSHRQKRLVARKKS
Subcellular Location(s) mito 13.5, mito_nucl 12.333, nucl 10, cyto_nucl 7.333
Family & Domain DBs
Amino Acid Sequences MFCHFRKKLRTKSHRQKRLVARKKSNPAVALHPKFQTMEPSTQTSIGHNDLNRRHDVIPNGLILTGAKLFATSFLLSSFSTLNCERRSRNA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.88
3 0.88
4 0.87
5 0.88
6 0.87
7 0.86
8 0.85
9 0.85
10 0.88
11 0.85
12 0.78
13 0.7
14 0.62
15 0.6
16 0.61
17 0.54
18 0.48
19 0.42
20 0.38
21 0.36
22 0.33
23 0.31
24 0.23
25 0.23
26 0.22
27 0.25
28 0.25
29 0.25
30 0.24
31 0.19
32 0.18
33 0.16
34 0.16
35 0.14
36 0.19
37 0.22
38 0.25
39 0.25
40 0.26
41 0.25
42 0.26
43 0.27
44 0.26
45 0.23
46 0.21
47 0.2
48 0.17
49 0.16
50 0.12
51 0.11
52 0.08
53 0.06
54 0.05
55 0.05
56 0.05
57 0.06
58 0.09
59 0.08
60 0.08
61 0.09
62 0.11
63 0.11
64 0.12
65 0.12
66 0.1
67 0.15
68 0.17
69 0.23
70 0.26
71 0.32