Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L0UNV7

Protein Details
Accession A0A0L0UNV7    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
69-88GKVNLKSPKRQRQQMLEQSQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24.5, cyto_nucl 15
Family & Domain DBs
InterPro View protein in InterPro  
IPR036638  HLH_DNA-bd_sf  
Gene Ontology GO:0046983  F:protein dimerization activity  
Amino Acid Sequences AIGKIPTGLSDGVKAATKLSKGNILSKSVDYMRHLLRRRAELKEDIEDLKEVVKSRVDGGEFLILQWEGKVNLKSPKRQRQQMLEQSQGEEDGDEDDDMHDSNHKKNNGAPHGNSGPNLSKKRKVADLKLGDTTKLKGGKLHGKGIRETSHTTDFRNHRLGPAHPESMILDSESLPPCSNCGSFDPNTGCGRQESMIRMNHDLVDELDVLREPPSNYHHQFIAQQQKAHDYSHLQSSGFSSDFMGHPFTPEPRSQQARGNPTVHYSLASCTFPLPSALGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.19
4 0.2
5 0.21
6 0.22
7 0.28
8 0.29
9 0.36
10 0.37
11 0.37
12 0.38
13 0.36
14 0.39
15 0.34
16 0.35
17 0.31
18 0.33
19 0.36
20 0.42
21 0.46
22 0.48
23 0.51
24 0.57
25 0.59
26 0.59
27 0.58
28 0.56
29 0.55
30 0.53
31 0.49
32 0.41
33 0.38
34 0.32
35 0.27
36 0.22
37 0.2
38 0.17
39 0.16
40 0.16
41 0.16
42 0.17
43 0.21
44 0.19
45 0.18
46 0.18
47 0.2
48 0.18
49 0.17
50 0.17
51 0.13
52 0.12
53 0.12
54 0.11
55 0.08
56 0.12
57 0.13
58 0.15
59 0.24
60 0.29
61 0.38
62 0.48
63 0.57
64 0.63
65 0.7
66 0.74
67 0.74
68 0.8
69 0.81
70 0.77
71 0.73
72 0.65
73 0.57
74 0.5
75 0.41
76 0.3
77 0.19
78 0.13
79 0.07
80 0.07
81 0.06
82 0.06
83 0.06
84 0.06
85 0.06
86 0.06
87 0.09
88 0.1
89 0.16
90 0.22
91 0.23
92 0.23
93 0.26
94 0.35
95 0.39
96 0.42
97 0.39
98 0.38
99 0.41
100 0.41
101 0.39
102 0.33
103 0.29
104 0.31
105 0.36
106 0.34
107 0.36
108 0.38
109 0.4
110 0.46
111 0.46
112 0.45
113 0.49
114 0.5
115 0.47
116 0.49
117 0.47
118 0.39
119 0.35
120 0.3
121 0.24
122 0.21
123 0.18
124 0.15
125 0.19
126 0.27
127 0.29
128 0.35
129 0.34
130 0.33
131 0.34
132 0.36
133 0.34
134 0.29
135 0.28
136 0.24
137 0.29
138 0.28
139 0.28
140 0.32
141 0.33
142 0.34
143 0.37
144 0.33
145 0.29
146 0.31
147 0.32
148 0.32
149 0.33
150 0.3
151 0.25
152 0.25
153 0.23
154 0.21
155 0.2
156 0.12
157 0.08
158 0.08
159 0.12
160 0.12
161 0.13
162 0.12
163 0.11
164 0.12
165 0.14
166 0.13
167 0.11
168 0.13
169 0.18
170 0.18
171 0.23
172 0.24
173 0.26
174 0.28
175 0.27
176 0.24
177 0.19
178 0.2
179 0.17
180 0.18
181 0.18
182 0.22
183 0.26
184 0.28
185 0.29
186 0.28
187 0.28
188 0.25
189 0.22
190 0.16
191 0.14
192 0.12
193 0.1
194 0.09
195 0.08
196 0.09
197 0.09
198 0.1
199 0.09
200 0.11
201 0.17
202 0.25
203 0.27
204 0.29
205 0.29
206 0.29
207 0.32
208 0.37
209 0.43
210 0.38
211 0.38
212 0.37
213 0.42
214 0.42
215 0.4
216 0.34
217 0.27
218 0.26
219 0.31
220 0.32
221 0.26
222 0.25
223 0.26
224 0.27
225 0.23
226 0.2
227 0.14
228 0.14
229 0.15
230 0.16
231 0.18
232 0.14
233 0.17
234 0.19
235 0.21
236 0.23
237 0.25
238 0.3
239 0.35
240 0.41
241 0.41
242 0.47
243 0.53
244 0.57
245 0.61
246 0.57
247 0.49
248 0.47
249 0.48
250 0.4
251 0.33
252 0.25
253 0.22
254 0.24
255 0.24
256 0.2
257 0.18
258 0.18
259 0.17
260 0.18