Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0UJK1

Protein Details
Accession A0A0L0UJK1    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
6-25GTGDRKPNTKQNRNGLARKPHydrophilic
NLS Segment(s)
PositionSequence
22-27ARKPPN
32-33RK
44-47ARKP
Subcellular Location(s) nucl 16, cyto_nucl 10.5, mito 7, cyto 3
Family & Domain DBs
Amino Acid Sequences MHRPGGTGDRKPNTKQNRNGLARKPPNGTENRKPNTNQNRHGLARKPANRTGTRKPNTNQNRNGHTRENDSNGLDPKVFVPIGSRGYHSFAGTSYAYTSDMSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.72
3 0.73
4 0.76
5 0.79
6 0.82
7 0.79
8 0.79
9 0.77
10 0.73
11 0.67
12 0.6
13 0.59
14 0.6
15 0.61
16 0.59
17 0.62
18 0.6
19 0.61
20 0.6
21 0.62
22 0.65
23 0.66
24 0.62
25 0.58
26 0.61
27 0.59
28 0.62
29 0.56
30 0.52
31 0.52
32 0.52
33 0.51
34 0.49
35 0.53
36 0.54
37 0.55
38 0.57
39 0.58
40 0.56
41 0.57
42 0.53
43 0.57
44 0.62
45 0.65
46 0.65
47 0.61
48 0.65
49 0.64
50 0.67
51 0.63
52 0.55
53 0.52
54 0.47
55 0.45
56 0.4
57 0.36
58 0.35
59 0.32
60 0.3
61 0.24
62 0.21
63 0.16
64 0.17
65 0.15
66 0.12
67 0.12
68 0.15
69 0.19
70 0.2
71 0.22
72 0.2
73 0.25
74 0.26
75 0.24
76 0.2
77 0.16
78 0.19
79 0.17
80 0.16
81 0.13
82 0.13
83 0.14