Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L0VEX6

Protein Details
Accession A0A0L0VEX6    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
16-45SDSSGSPIPPRRPKKKKTPARQKTPIDISSHydrophilic
NLS Segment(s)
PositionSequence
24-37PPRRPKKKKTPARQ
Subcellular Location(s) plas 18, nucl 5, cyto 1, E.R. 1, golg 1, vacu 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MDSSRRGPPPPYNSDSDSSGSPIPPRRPKKKKTPARQKTPIDISSSSEEEEELKPSLQAHLPALTTPPPNLKQSPVPLGPVLAPVPLGLVLAPVPLALVLAPVLLVLVLLVLVLLVPVLLVLVLLVPSPRPASPRPASLRPASPRPASPCPASPCPASPCPASPQLAPDREECEAEFVAGQIPDNTAERREVIPYGTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.53
3 0.45
4 0.38
5 0.32
6 0.29
7 0.25
8 0.27
9 0.31
10 0.37
11 0.45
12 0.55
13 0.63
14 0.71
15 0.79
16 0.85
17 0.89
18 0.9
19 0.91
20 0.93
21 0.92
22 0.93
23 0.94
24 0.89
25 0.87
26 0.84
27 0.75
28 0.68
29 0.59
30 0.51
31 0.45
32 0.4
33 0.31
34 0.23
35 0.2
36 0.18
37 0.17
38 0.16
39 0.13
40 0.12
41 0.12
42 0.12
43 0.14
44 0.13
45 0.14
46 0.13
47 0.14
48 0.14
49 0.13
50 0.15
51 0.15
52 0.15
53 0.14
54 0.19
55 0.19
56 0.23
57 0.24
58 0.25
59 0.26
60 0.29
61 0.34
62 0.29
63 0.28
64 0.24
65 0.24
66 0.21
67 0.18
68 0.15
69 0.09
70 0.08
71 0.06
72 0.06
73 0.05
74 0.05
75 0.03
76 0.03
77 0.03
78 0.03
79 0.03
80 0.03
81 0.02
82 0.02
83 0.02
84 0.02
85 0.02
86 0.02
87 0.02
88 0.02
89 0.02
90 0.02
91 0.02
92 0.02
93 0.01
94 0.01
95 0.01
96 0.01
97 0.01
98 0.01
99 0.01
100 0.01
101 0.01
102 0.01
103 0.01
104 0.01
105 0.01
106 0.01
107 0.01
108 0.01
109 0.02
110 0.02
111 0.02
112 0.02
113 0.03
114 0.04
115 0.06
116 0.06
117 0.1
118 0.12
119 0.2
120 0.23
121 0.31
122 0.37
123 0.41
124 0.44
125 0.44
126 0.5
127 0.47
128 0.51
129 0.48
130 0.44
131 0.44
132 0.47
133 0.49
134 0.45
135 0.43
136 0.44
137 0.46
138 0.47
139 0.46
140 0.4
141 0.39
142 0.42
143 0.41
144 0.37
145 0.32
146 0.3
147 0.32
148 0.35
149 0.33
150 0.27
151 0.31
152 0.37
153 0.39
154 0.38
155 0.35
156 0.34
157 0.34
158 0.34
159 0.28
160 0.24
161 0.2
162 0.19
163 0.16
164 0.12
165 0.14
166 0.13
167 0.13
168 0.09
169 0.1
170 0.12
171 0.14
172 0.16
173 0.15
174 0.16
175 0.18
176 0.19
177 0.21
178 0.21