Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C6HSY5

Protein Details
Accession C6HSY5   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
113-145KNEKNLRNPDPRSRRRRLHRRVRSPHPSRPPLPBasic
NLS Segment(s)
PositionSequence
120-144NPDPRSRRRRLHRRVRSPHPSRPPL
Subcellular Location(s) nucl 14, cyto 7, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR013785  Aldolase_TIM  
IPR001852  PdxS/SNZ  
IPR033755  PdxS/SNZ_N  
Gene Ontology GO:0042823  P:pyridoxal phosphate biosynthetic process  
Pfam View protein in Pfam  
PF01680  SOR_SNZ  
PROSITE View protein in PROSITE  
PS51129  PDXS_SNZ_2  
Amino Acid Sequences MAPEISTGSDAVASASSSSPVDFKVKTGLAQMLKGGVIMDVVNAEQARIAEEAGACAVMALERVPADIRAEGGVSRMSDPSMIKEIMEAVTIPVMAKARIGHFVECQCVSLTKNEKNLRNPDPRSRRRRLHRRVRSPHPSRPPLPRHQAQLQSALRLWLRTWAKPSAASRALR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.09
4 0.09
5 0.09
6 0.09
7 0.11
8 0.15
9 0.14
10 0.15
11 0.19
12 0.2
13 0.2
14 0.23
15 0.27
16 0.24
17 0.25
18 0.24
19 0.19
20 0.18
21 0.17
22 0.14
23 0.08
24 0.07
25 0.06
26 0.05
27 0.04
28 0.04
29 0.06
30 0.06
31 0.06
32 0.06
33 0.06
34 0.07
35 0.07
36 0.07
37 0.07
38 0.07
39 0.07
40 0.07
41 0.06
42 0.05
43 0.04
44 0.04
45 0.03
46 0.03
47 0.03
48 0.03
49 0.03
50 0.04
51 0.05
52 0.05
53 0.06
54 0.06
55 0.07
56 0.06
57 0.07
58 0.06
59 0.07
60 0.07
61 0.07
62 0.08
63 0.07
64 0.07
65 0.08
66 0.08
67 0.1
68 0.11
69 0.11
70 0.1
71 0.1
72 0.1
73 0.09
74 0.09
75 0.07
76 0.04
77 0.04
78 0.04
79 0.04
80 0.05
81 0.05
82 0.05
83 0.06
84 0.07
85 0.08
86 0.12
87 0.14
88 0.14
89 0.16
90 0.17
91 0.19
92 0.18
93 0.18
94 0.14
95 0.14
96 0.14
97 0.17
98 0.23
99 0.24
100 0.33
101 0.39
102 0.44
103 0.5
104 0.57
105 0.59
106 0.62
107 0.64
108 0.66
109 0.7
110 0.75
111 0.77
112 0.79
113 0.8
114 0.82
115 0.88
116 0.88
117 0.88
118 0.89
119 0.91
120 0.92
121 0.92
122 0.92
123 0.89
124 0.88
125 0.87
126 0.84
127 0.78
128 0.79
129 0.77
130 0.75
131 0.77
132 0.72
133 0.69
134 0.68
135 0.71
136 0.63
137 0.65
138 0.57
139 0.51
140 0.47
141 0.43
142 0.36
143 0.3
144 0.27
145 0.26
146 0.29
147 0.29
148 0.33
149 0.34
150 0.35
151 0.41
152 0.44
153 0.44