Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L0V1A0

Protein Details
Accession A0A0L0V1A0    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
18-41EGNPIKVKKVKKEKDPNAPKRPLSBasic
NLS Segment(s)
PositionSequence
20-38NPIKVKKVKKEKDPNAPKR
Subcellular Location(s) nucl 21, cyto_nucl 13.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKETTAATKRAPKLDAEGNPIKVKKVKKEKDPNAPKRPLSAYMFFSQDWRERIKTENPEVSFGEIGRLLGLKWKGLTDEEKKPYEDMAARDKKRHEAEKAEYERS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.47
3 0.45
4 0.44
5 0.44
6 0.43
7 0.47
8 0.46
9 0.43
10 0.4
11 0.42
12 0.44
13 0.5
14 0.54
15 0.6
16 0.71
17 0.77
18 0.82
19 0.88
20 0.88
21 0.87
22 0.86
23 0.76
24 0.69
25 0.63
26 0.57
27 0.5
28 0.43
29 0.36
30 0.31
31 0.32
32 0.28
33 0.26
34 0.23
35 0.22
36 0.2
37 0.2
38 0.19
39 0.18
40 0.22
41 0.27
42 0.31
43 0.32
44 0.37
45 0.34
46 0.36
47 0.35
48 0.33
49 0.27
50 0.21
51 0.17
52 0.11
53 0.1
54 0.07
55 0.07
56 0.05
57 0.1
58 0.11
59 0.11
60 0.11
61 0.11
62 0.12
63 0.15
64 0.22
65 0.22
66 0.31
67 0.36
68 0.38
69 0.39
70 0.38
71 0.37
72 0.35
73 0.33
74 0.28
75 0.33
76 0.4
77 0.42
78 0.47
79 0.5
80 0.54
81 0.58
82 0.62
83 0.58
84 0.57
85 0.63
86 0.68