Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L0UMZ3

Protein Details
Accession A0A0L0UMZ3    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
81-100EYNNTKKIFSRPKDKRTEDYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto_nucl 13.5, cyto 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR003439  ABC_transporter-like_ATP-bd  
IPR027417  P-loop_NTPase  
IPR005670  Phosp_transpt1  
Gene Ontology GO:0016020  C:membrane  
GO:0005524  F:ATP binding  
GO:0005315  F:inorganic phosphate transmembrane transporter activity  
GO:0035435  P:phosphate ion transmembrane transport  
Pfam View protein in Pfam  
PF00005  ABC_tran  
Amino Acid Sequences LSLSGGQQQRECIARAIALKPEVLLMDEPTSALDPIAASKIEDLMNDLKSDFTIIVVTHSMQQAARISDKTAFFLNGELIEYNNTKKIFSRPKDKRTEDYITGRFG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.23
3 0.24
4 0.24
5 0.23
6 0.21
7 0.19
8 0.19
9 0.16
10 0.14
11 0.12
12 0.1
13 0.1
14 0.1
15 0.1
16 0.1
17 0.1
18 0.09
19 0.08
20 0.06
21 0.05
22 0.06
23 0.07
24 0.06
25 0.06
26 0.06
27 0.08
28 0.08
29 0.08
30 0.09
31 0.1
32 0.11
33 0.11
34 0.11
35 0.09
36 0.09
37 0.09
38 0.07
39 0.05
40 0.05
41 0.04
42 0.05
43 0.06
44 0.06
45 0.08
46 0.08
47 0.08
48 0.07
49 0.09
50 0.1
51 0.11
52 0.13
53 0.12
54 0.13
55 0.17
56 0.17
57 0.17
58 0.16
59 0.15
60 0.14
61 0.14
62 0.14
63 0.1
64 0.1
65 0.09
66 0.08
67 0.1
68 0.11
69 0.12
70 0.16
71 0.16
72 0.16
73 0.18
74 0.28
75 0.36
76 0.42
77 0.52
78 0.58
79 0.67
80 0.78
81 0.81
82 0.78
83 0.75
84 0.76
85 0.72
86 0.71