Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0VLE0

Protein Details
Accession A0A0L0VLE0   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
5-24APPTSKPCTRAPKVAKCEKNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13.5, mito_nucl 13, nucl 11.5
Family & Domain DBs
Amino Acid Sequences MAEPAPPTSKPCTRAPKVAKCEKNTSICALIQSLNWSTKDFMLAFLKDSKHQDVAISRRYWVTDQGWDSTKDLLLTTKRLAQRHIKGCEHWEAFILSQRFVTWRILLHHIIVGKHIFL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.68
3 0.71
4 0.74
5 0.8
6 0.79
7 0.75
8 0.78
9 0.74
10 0.7
11 0.62
12 0.56
13 0.49
14 0.41
15 0.36
16 0.3
17 0.24
18 0.18
19 0.19
20 0.17
21 0.17
22 0.17
23 0.17
24 0.16
25 0.16
26 0.18
27 0.15
28 0.15
29 0.16
30 0.16
31 0.16
32 0.19
33 0.19
34 0.2
35 0.23
36 0.22
37 0.2
38 0.2
39 0.2
40 0.21
41 0.25
42 0.28
43 0.25
44 0.24
45 0.23
46 0.24
47 0.22
48 0.21
49 0.18
50 0.17
51 0.18
52 0.2
53 0.21
54 0.21
55 0.21
56 0.19
57 0.17
58 0.13
59 0.12
60 0.13
61 0.13
62 0.14
63 0.15
64 0.2
65 0.24
66 0.25
67 0.3
68 0.35
69 0.43
70 0.49
71 0.55
72 0.52
73 0.5
74 0.52
75 0.56
76 0.48
77 0.39
78 0.32
79 0.26
80 0.24
81 0.29
82 0.26
83 0.18
84 0.17
85 0.17
86 0.17
87 0.18
88 0.2
89 0.15
90 0.18
91 0.21
92 0.26
93 0.27
94 0.27
95 0.28
96 0.27
97 0.26
98 0.26