Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0UYD2

Protein Details
Accession A0A0L0UYD2   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
82-109KGMSFDTKSKKPRPRKRSASWNRQNWLWHydrophilic
NLS Segment(s)
PositionSequence
89-99KSKKPRPRKRS
Subcellular Location(s) nucl 13.5, mito_nucl 12.499, cyto_nucl 10.666, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR032549  DUF4939  
Pfam View protein in Pfam  
PF16297  DUF4939  
Amino Acid Sequences MKNDFINGYWPITTRGDKAKAFTNQAGLYMSANTAKVPTDQIKVIFCISNLTGSAITWAKPYLNMLLNDEEVKFDQFCTTFKGMSFDTKSKKPRPRKRSASWNRQNWLWQTPIKLQLTPLIWVGKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.31
3 0.35
4 0.35
5 0.37
6 0.41
7 0.42
8 0.45
9 0.43
10 0.4
11 0.34
12 0.34
13 0.33
14 0.25
15 0.2
16 0.15
17 0.14
18 0.1
19 0.1
20 0.09
21 0.08
22 0.08
23 0.09
24 0.12
25 0.14
26 0.16
27 0.17
28 0.19
29 0.19
30 0.2
31 0.2
32 0.16
33 0.14
34 0.13
35 0.12
36 0.11
37 0.1
38 0.1
39 0.09
40 0.08
41 0.11
42 0.09
43 0.09
44 0.08
45 0.09
46 0.07
47 0.08
48 0.09
49 0.09
50 0.12
51 0.12
52 0.14
53 0.15
54 0.15
55 0.16
56 0.15
57 0.13
58 0.1
59 0.1
60 0.08
61 0.07
62 0.08
63 0.08
64 0.09
65 0.14
66 0.15
67 0.14
68 0.15
69 0.17
70 0.17
71 0.22
72 0.26
73 0.27
74 0.3
75 0.37
76 0.45
77 0.52
78 0.61
79 0.67
80 0.73
81 0.77
82 0.83
83 0.86
84 0.88
85 0.9
86 0.9
87 0.91
88 0.9
89 0.89
90 0.82
91 0.74
92 0.71
93 0.63
94 0.57
95 0.51
96 0.43
97 0.39
98 0.41
99 0.46
100 0.43
101 0.4
102 0.36
103 0.37
104 0.36
105 0.33
106 0.31