Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L0UW89

Protein Details
Accession A0A0L0UW89    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
32-54RLDLRKNRKGKYRIRRQRYEISTBasic
NLS Segment(s)
PositionSequence
37-46KNRKGKYRIR
Subcellular Location(s) mito 7, nucl 6, cysk 5, cyto_pero 4, cyto 3.5, pero 3.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MITHWNEPECTQSGQLRFWLLKPVFSFRCIIRLDLRKNRKGKYRIRRQRYEISTESDSSRWPLPPGVGFMTNLLYCTITWMMGLLGEFLAHRGLLNL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.3
3 0.29
4 0.27
5 0.25
6 0.32
7 0.26
8 0.28
9 0.28
10 0.34
11 0.31
12 0.32
13 0.33
14 0.24
15 0.3
16 0.27
17 0.27
18 0.28
19 0.34
20 0.41
21 0.49
22 0.57
23 0.58
24 0.63
25 0.66
26 0.68
27 0.68
28 0.7
29 0.71
30 0.74
31 0.77
32 0.8
33 0.83
34 0.8
35 0.8
36 0.74
37 0.7
38 0.6
39 0.55
40 0.48
41 0.42
42 0.37
43 0.28
44 0.24
45 0.2
46 0.19
47 0.15
48 0.14
49 0.13
50 0.13
51 0.14
52 0.16
53 0.16
54 0.16
55 0.15
56 0.15
57 0.16
58 0.15
59 0.14
60 0.12
61 0.1
62 0.09
63 0.12
64 0.12
65 0.09
66 0.09
67 0.09
68 0.08
69 0.09
70 0.09
71 0.06
72 0.05
73 0.06
74 0.06
75 0.06
76 0.07
77 0.06