Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0W111

Protein Details
Accession A0A0L0W111    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
6-37SSFGKRHSKTHTQCRRCGRRSFHKQHKTCAACHydrophilic
NLS Segment(s)
PositionSequence
52-75KAKRRHTTGTGRMRHLKDVPRRFK
Subcellular Location(s) mito 11, cyto 9, mito_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR011331  Ribosomal_L37ae/L37e  
IPR001569  Ribosomal_L37e  
IPR018267  Ribosomal_L37e_CS  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0046872  F:metal ion binding  
GO:0019843  F:rRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01907  Ribosomal_L37e  
PROSITE View protein in PROSITE  
PS01077  RIBOSOMAL_L37E  
Amino Acid Sequences MTKGTSSFGKRHSKTHTQCRRCGRRSFHKQHKTCAACGYPAAKTRSYEWGAKAKRRHTTGTGRMRHLKDVPRRFKNGFREGGVATRKTPVAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.73
3 0.76
4 0.72
5 0.78
6 0.83
7 0.85
8 0.81
9 0.81
10 0.79
11 0.79
12 0.83
13 0.86
14 0.86
15 0.86
16 0.82
17 0.8
18 0.81
19 0.73
20 0.63
21 0.58
22 0.48
23 0.38
24 0.36
25 0.3
26 0.23
27 0.25
28 0.26
29 0.22
30 0.22
31 0.23
32 0.28
33 0.28
34 0.28
35 0.25
36 0.32
37 0.35
38 0.4
39 0.44
40 0.44
41 0.48
42 0.49
43 0.5
44 0.47
45 0.53
46 0.57
47 0.61
48 0.6
49 0.59
50 0.64
51 0.62
52 0.6
53 0.56
54 0.55
55 0.55
56 0.61
57 0.65
58 0.64
59 0.69
60 0.69
61 0.71
62 0.72
63 0.7
64 0.65
65 0.57
66 0.54
67 0.48
68 0.52
69 0.49
70 0.41
71 0.34
72 0.32