Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0VHE7

Protein Details
Accession A0A0L0VHE7    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
139-165GDWAPEGKKRKNGKKLFHMHHSNKQLFHydrophilic
NLS Segment(s)
PositionSequence
145-153GKKRKNGKK
Subcellular Location(s) cyto_nucl 10.333, cyto 10, mito_nucl 8.666, nucl 8.5, mito 7.5
Family & Domain DBs
Amino Acid Sequences MAHEGDLDTLVKGEVKKALVSGKVYVAKVCWNQHNIWKSYARVVEPSLGKKINIQLFPGNPTVLRQIQKLEHGKWILMQGYSAHSLLQEDGILKVKFPGKILSSFGVYKMDAFETSTHSQSTGYHLWSDPKKRFNLHVGDWAPEGKKRKNGKKLFHMHHSNKQLFSEVHS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.16
4 0.18
5 0.22
6 0.23
7 0.25
8 0.25
9 0.27
10 0.3
11 0.3
12 0.29
13 0.26
14 0.28
15 0.32
16 0.35
17 0.35
18 0.34
19 0.36
20 0.43
21 0.5
22 0.46
23 0.45
24 0.43
25 0.38
26 0.4
27 0.41
28 0.35
29 0.29
30 0.28
31 0.29
32 0.29
33 0.31
34 0.3
35 0.27
36 0.26
37 0.26
38 0.31
39 0.32
40 0.29
41 0.29
42 0.28
43 0.28
44 0.31
45 0.29
46 0.23
47 0.17
48 0.17
49 0.19
50 0.2
51 0.2
52 0.17
53 0.19
54 0.21
55 0.28
56 0.32
57 0.29
58 0.29
59 0.29
60 0.28
61 0.26
62 0.26
63 0.2
64 0.15
65 0.14
66 0.09
67 0.1
68 0.12
69 0.11
70 0.09
71 0.07
72 0.08
73 0.07
74 0.07
75 0.05
76 0.04
77 0.05
78 0.1
79 0.1
80 0.09
81 0.12
82 0.14
83 0.15
84 0.16
85 0.18
86 0.16
87 0.18
88 0.2
89 0.19
90 0.19
91 0.18
92 0.18
93 0.16
94 0.14
95 0.12
96 0.11
97 0.11
98 0.09
99 0.1
100 0.1
101 0.14
102 0.16
103 0.17
104 0.16
105 0.16
106 0.16
107 0.15
108 0.2
109 0.17
110 0.16
111 0.17
112 0.18
113 0.24
114 0.31
115 0.38
116 0.39
117 0.43
118 0.46
119 0.48
120 0.52
121 0.53
122 0.53
123 0.48
124 0.51
125 0.46
126 0.44
127 0.42
128 0.4
129 0.34
130 0.32
131 0.35
132 0.31
133 0.39
134 0.48
135 0.57
136 0.65
137 0.73
138 0.78
139 0.82
140 0.87
141 0.85
142 0.85
143 0.86
144 0.83
145 0.83
146 0.83
147 0.77
148 0.69
149 0.63
150 0.57