Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C6HIT0

Protein Details
Accession C6HIT0    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
6-26ESPAQRAARLRRERREAKIKAHydrophilic
NLS Segment(s)
PositionSequence
13-25ARLRRERREAKIK
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR028143  Get2/sif1  
Pfam View protein in Pfam  
PF08690  GET2  
Amino Acid Sequences MSAAEESPAQRAARLRRERREAKIKADGSARLDKITSLSGRTPASTLREDSPPSLSDSSPTPGHRPQTLSKSSSPLPPPPNVEDQAPENLKAQEEYLRAFYAHNSHWTNRLLRKIHQTY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.57
3 0.62
4 0.73
5 0.77
6 0.81
7 0.83
8 0.77
9 0.74
10 0.74
11 0.66
12 0.6
13 0.56
14 0.5
15 0.44
16 0.46
17 0.39
18 0.3
19 0.29
20 0.25
21 0.23
22 0.23
23 0.19
24 0.14
25 0.15
26 0.17
27 0.18
28 0.18
29 0.17
30 0.16
31 0.19
32 0.18
33 0.19
34 0.18
35 0.2
36 0.21
37 0.21
38 0.21
39 0.18
40 0.19
41 0.18
42 0.16
43 0.14
44 0.15
45 0.16
46 0.17
47 0.17
48 0.18
49 0.19
50 0.22
51 0.23
52 0.25
53 0.27
54 0.32
55 0.35
56 0.34
57 0.33
58 0.34
59 0.34
60 0.36
61 0.35
62 0.35
63 0.34
64 0.34
65 0.37
66 0.36
67 0.4
68 0.35
69 0.33
70 0.28
71 0.27
72 0.31
73 0.28
74 0.26
75 0.23
76 0.22
77 0.22
78 0.2
79 0.19
80 0.17
81 0.17
82 0.18
83 0.18
84 0.18
85 0.18
86 0.18
87 0.19
88 0.19
89 0.2
90 0.26
91 0.28
92 0.29
93 0.34
94 0.38
95 0.43
96 0.44
97 0.51
98 0.47
99 0.5