Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6BNK5

Protein Details
Accession Q6BNK5    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
17-37IFSLKQQRDKLKQYQRKLNTIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto 3.5, cyto_pero 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005024  Snf7_fam  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0043231  C:intracellular membrane-bounded organelle  
GO:0045324  P:late endosome to vacuole transport  
KEGG dha:DEHA2E20988g  -  
Pfam View protein in Pfam  
PF03357  Snf7  
Amino Acid Sequences MGQQTSTPKITSQDRAIFSLKQQRDKLKQYQRKLNTIIERQNKLAKEAIIKKDNARAKVYLRSKKQQQTTITKTYEQLDNLETLIGTIEFKLIEKDVMYGLEQGNEVLKTLNSEMSVDKIDKVLDGLEDERLKVDEVSDMLGMGSGLSNGEEHEVDEELANLEAEVNGTKKVETEASQDIDMPAVPDTKPESKIPDEEEEKEEKPVKSKPNEPIAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.47
3 0.49
4 0.45
5 0.45
6 0.49
7 0.46
8 0.47
9 0.51
10 0.57
11 0.62
12 0.69
13 0.73
14 0.74
15 0.78
16 0.79
17 0.83
18 0.81
19 0.8
20 0.77
21 0.75
22 0.72
23 0.71
24 0.71
25 0.69
26 0.65
27 0.6
28 0.61
29 0.53
30 0.47
31 0.42
32 0.35
33 0.35
34 0.4
35 0.45
36 0.44
37 0.45
38 0.45
39 0.5
40 0.53
41 0.48
42 0.43
43 0.38
44 0.36
45 0.44
46 0.51
47 0.52
48 0.53
49 0.58
50 0.64
51 0.69
52 0.72
53 0.7
54 0.68
55 0.69
56 0.69
57 0.69
58 0.62
59 0.55
60 0.5
61 0.45
62 0.4
63 0.31
64 0.26
65 0.18
66 0.17
67 0.15
68 0.13
69 0.1
70 0.07
71 0.07
72 0.05
73 0.04
74 0.04
75 0.04
76 0.04
77 0.04
78 0.05
79 0.05
80 0.05
81 0.05
82 0.06
83 0.06
84 0.07
85 0.07
86 0.08
87 0.07
88 0.08
89 0.08
90 0.07
91 0.07
92 0.07
93 0.07
94 0.05
95 0.05
96 0.05
97 0.06
98 0.07
99 0.06
100 0.07
101 0.07
102 0.08
103 0.1
104 0.09
105 0.09
106 0.09
107 0.08
108 0.07
109 0.08
110 0.06
111 0.05
112 0.06
113 0.06
114 0.09
115 0.09
116 0.09
117 0.1
118 0.1
119 0.1
120 0.09
121 0.09
122 0.06
123 0.07
124 0.08
125 0.07
126 0.07
127 0.06
128 0.06
129 0.05
130 0.04
131 0.04
132 0.03
133 0.03
134 0.03
135 0.03
136 0.04
137 0.05
138 0.05
139 0.05
140 0.06
141 0.07
142 0.07
143 0.07
144 0.07
145 0.07
146 0.07
147 0.06
148 0.05
149 0.05
150 0.04
151 0.05
152 0.06
153 0.06
154 0.07
155 0.07
156 0.07
157 0.08
158 0.1
159 0.12
160 0.13
161 0.17
162 0.21
163 0.23
164 0.23
165 0.23
166 0.21
167 0.19
168 0.18
169 0.13
170 0.1
171 0.09
172 0.09
173 0.1
174 0.16
175 0.2
176 0.23
177 0.25
178 0.3
179 0.32
180 0.36
181 0.39
182 0.42
183 0.42
184 0.43
185 0.45
186 0.44
187 0.42
188 0.44
189 0.45
190 0.38
191 0.39
192 0.43
193 0.48
194 0.51
195 0.58
196 0.6