Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C6H8F9

Protein Details
Accession C6H8F9   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
81-101TLPRPVKPKEQEKRPSNPKHGBasic
NLS Segment(s)
Subcellular Location(s) mito 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR038340  MRP-L47_sf  
IPR010729  Ribosomal_L47_mit  
Gene Ontology GO:0005761  C:mitochondrial ribosome  
GO:1990904  C:ribonucleoprotein complex  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF06984  MRP-L47  
Amino Acid Sequences MPSRTITRLVRLYGGTPLVELPPIFLAPALQFPSLHFASFQCLKFSTTPAPGLKRDLSKHRGVSAIHRTGPRYPLSVSKYTLPRPVKPKEQEKRPSNPKHGLWGFFGPDRKPIPTPEEEYAHGRAWSIQELRQKSWDDLHKLYWLCVKERNRIATARYERQRLQAGYGDYESNNRDKTVRGTQQSIKQALRERWYAWEDARQLYESGEYSPADAQVMEAEAYAYEPPALDVEEPKGEASDSVKSPPSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.24
3 0.2
4 0.19
5 0.16
6 0.16
7 0.14
8 0.11
9 0.11
10 0.11
11 0.11
12 0.09
13 0.1
14 0.09
15 0.14
16 0.15
17 0.14
18 0.14
19 0.15
20 0.21
21 0.21
22 0.2
23 0.16
24 0.14
25 0.19
26 0.26
27 0.26
28 0.22
29 0.23
30 0.25
31 0.26
32 0.29
33 0.28
34 0.25
35 0.3
36 0.32
37 0.36
38 0.35
39 0.38
40 0.39
41 0.4
42 0.42
43 0.46
44 0.46
45 0.49
46 0.5
47 0.47
48 0.47
49 0.42
50 0.45
51 0.45
52 0.45
53 0.42
54 0.41
55 0.41
56 0.41
57 0.44
58 0.37
59 0.29
60 0.26
61 0.29
62 0.32
63 0.33
64 0.32
65 0.34
66 0.37
67 0.38
68 0.45
69 0.42
70 0.42
71 0.46
72 0.5
73 0.54
74 0.57
75 0.65
76 0.65
77 0.72
78 0.76
79 0.75
80 0.79
81 0.8
82 0.81
83 0.78
84 0.76
85 0.67
86 0.66
87 0.62
88 0.54
89 0.46
90 0.39
91 0.33
92 0.29
93 0.3
94 0.21
95 0.23
96 0.22
97 0.22
98 0.21
99 0.21
100 0.24
101 0.25
102 0.28
103 0.26
104 0.27
105 0.26
106 0.28
107 0.28
108 0.24
109 0.2
110 0.16
111 0.15
112 0.13
113 0.15
114 0.13
115 0.14
116 0.19
117 0.22
118 0.23
119 0.26
120 0.27
121 0.25
122 0.29
123 0.31
124 0.3
125 0.29
126 0.3
127 0.3
128 0.29
129 0.29
130 0.27
131 0.23
132 0.2
133 0.26
134 0.29
135 0.32
136 0.37
137 0.4
138 0.38
139 0.39
140 0.39
141 0.41
142 0.44
143 0.45
144 0.45
145 0.46
146 0.44
147 0.47
148 0.51
149 0.42
150 0.38
151 0.34
152 0.31
153 0.28
154 0.28
155 0.24
156 0.18
157 0.2
158 0.19
159 0.18
160 0.17
161 0.16
162 0.16
163 0.16
164 0.22
165 0.29
166 0.34
167 0.35
168 0.4
169 0.45
170 0.52
171 0.57
172 0.56
173 0.48
174 0.45
175 0.49
176 0.49
177 0.48
178 0.43
179 0.37
180 0.38
181 0.4
182 0.38
183 0.32
184 0.33
185 0.31
186 0.31
187 0.31
188 0.26
189 0.24
190 0.22
191 0.22
192 0.16
193 0.15
194 0.15
195 0.13
196 0.13
197 0.13
198 0.13
199 0.12
200 0.11
201 0.09
202 0.08
203 0.09
204 0.07
205 0.07
206 0.06
207 0.06
208 0.07
209 0.07
210 0.07
211 0.06
212 0.06
213 0.06
214 0.07
215 0.08
216 0.08
217 0.1
218 0.14
219 0.16
220 0.16
221 0.16
222 0.16
223 0.15
224 0.15
225 0.16
226 0.18
227 0.18
228 0.22