Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0V092

Protein Details
Accession A0A0L0V092   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
102-128MGKPAFDKQKKLKLKPRNWKWTSRVQDHydrophilic
NLS Segment(s)
PositionSequence
111-117KKLKLKP
Subcellular Location(s) nucl 13, mito_nucl 11.333, cyto_nucl 9.333, mito 8.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007052  CS_dom  
IPR008978  HSP20-like_chaperone  
Pfam View protein in Pfam  
PF04969  CS  
Amino Acid Sequences MNAREEEEQAKLPFTWNQTLQHLGLNIPAPPRTKAHDLVMEISKTKLKVGLKGKEEILDSMLCKESKWGGSTRTLGGLVDRLKQRKIANHKKTMFNNQNMQMGKPAFDKQKKLKLKPRNWKWTSRVQDWMILKQLPTPKVNIHP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.3
3 0.29
4 0.32
5 0.33
6 0.36
7 0.34
8 0.32
9 0.29
10 0.22
11 0.22
12 0.19
13 0.18
14 0.16
15 0.19
16 0.18
17 0.2
18 0.22
19 0.25
20 0.29
21 0.3
22 0.32
23 0.34
24 0.34
25 0.35
26 0.37
27 0.32
28 0.28
29 0.26
30 0.23
31 0.19
32 0.17
33 0.18
34 0.16
35 0.23
36 0.31
37 0.37
38 0.37
39 0.4
40 0.4
41 0.37
42 0.36
43 0.29
44 0.22
45 0.16
46 0.13
47 0.12
48 0.14
49 0.11
50 0.11
51 0.11
52 0.12
53 0.12
54 0.14
55 0.14
56 0.14
57 0.17
58 0.19
59 0.18
60 0.17
61 0.16
62 0.14
63 0.12
64 0.14
65 0.12
66 0.15
67 0.18
68 0.19
69 0.2
70 0.24
71 0.27
72 0.31
73 0.41
74 0.47
75 0.53
76 0.61
77 0.65
78 0.68
79 0.71
80 0.74
81 0.71
82 0.66
83 0.64
84 0.57
85 0.58
86 0.51
87 0.47
88 0.41
89 0.33
90 0.29
91 0.24
92 0.26
93 0.29
94 0.34
95 0.41
96 0.45
97 0.55
98 0.62
99 0.69
100 0.74
101 0.76
102 0.82
103 0.85
104 0.88
105 0.89
106 0.85
107 0.85
108 0.8
109 0.8
110 0.78
111 0.72
112 0.69
113 0.6
114 0.62
115 0.56
116 0.55
117 0.5
118 0.43
119 0.38
120 0.35
121 0.4
122 0.38
123 0.36
124 0.35