Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0VLR8

Protein Details
Accession A0A0L0VLR8    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
10-36GCRNRQPGTPHRTRKERRSRSTKLAAAHydrophilic
NLS Segment(s)
PositionSequence
23-27RKERR
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
Amino Acid Sequences MVKNDNTSSGCRNRQPGTPHRTRKERRSRSTKLAAAQVFSTTVIPRTRIKDIEQVALQTRITDNTIGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.55
3 0.58
4 0.59
5 0.63
6 0.68
7 0.69
8 0.77
9 0.78
10 0.81
11 0.83
12 0.84
13 0.84
14 0.84
15 0.82
16 0.8
17 0.81
18 0.74
19 0.65
20 0.61
21 0.51
22 0.42
23 0.35
24 0.27
25 0.19
26 0.16
27 0.14
28 0.08
29 0.11
30 0.11
31 0.13
32 0.17
33 0.21
34 0.25
35 0.27
36 0.3
37 0.34
38 0.36
39 0.39
40 0.36
41 0.35
42 0.33
43 0.33
44 0.3
45 0.23
46 0.22
47 0.18
48 0.19