Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0UYI1

Protein Details
Accession A0A0L0UYI1   
Localization Confidence Medium
Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
43-73TSEEEKPATKQQRKRRSKPQLPRRNMRPSRLHydrophilic
NLS Segment(s)
PositionSequence
51-83TKQQRKRRSKPQLPRRNMRPSRLPTTLPPKKKI
Subcellular Location(s) nucl 17, cyto 7, mito 2
Family & Domain DBs
Amino Acid Sequences MSEEEGSTSEEEESTSEEEESTSEEEESTSEEEESKSEVEESTSEEEKPATKQQRKRRSKPQLPRRNMRPSRLPTTLPPKKKITPVKTASLPSTKKIIPMRTATLCPCPPTTLNAFEHVVFFFSEIWFQTFFPHFSPPPNNDPPIFLGSANKHFVPLVLSSSIMFPAPRLLKDWPPKATAEALKWESKYEDCGQEAFIPF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.11
4 0.11
5 0.11
6 0.11
7 0.13
8 0.12
9 0.11
10 0.1
11 0.1
12 0.1
13 0.1
14 0.13
15 0.12
16 0.11
17 0.11
18 0.11
19 0.12
20 0.12
21 0.14
22 0.11
23 0.1
24 0.1
25 0.1
26 0.1
27 0.1
28 0.13
29 0.15
30 0.16
31 0.16
32 0.16
33 0.16
34 0.16
35 0.2
36 0.26
37 0.31
38 0.39
39 0.47
40 0.58
41 0.68
42 0.78
43 0.83
44 0.85
45 0.86
46 0.89
47 0.91
48 0.92
49 0.91
50 0.9
51 0.9
52 0.88
53 0.87
54 0.82
55 0.77
56 0.76
57 0.71
58 0.69
59 0.63
60 0.56
61 0.51
62 0.56
63 0.59
64 0.55
65 0.53
66 0.52
67 0.52
68 0.59
69 0.63
70 0.58
71 0.59
72 0.58
73 0.57
74 0.55
75 0.53
76 0.48
77 0.45
78 0.4
79 0.32
80 0.32
81 0.27
82 0.29
83 0.31
84 0.31
85 0.27
86 0.29
87 0.31
88 0.29
89 0.31
90 0.27
91 0.28
92 0.26
93 0.24
94 0.22
95 0.2
96 0.18
97 0.19
98 0.21
99 0.21
100 0.21
101 0.22
102 0.22
103 0.2
104 0.21
105 0.18
106 0.15
107 0.1
108 0.1
109 0.07
110 0.06
111 0.07
112 0.07
113 0.08
114 0.08
115 0.08
116 0.11
117 0.12
118 0.13
119 0.14
120 0.18
121 0.17
122 0.21
123 0.27
124 0.28
125 0.35
126 0.38
127 0.39
128 0.36
129 0.37
130 0.35
131 0.32
132 0.29
133 0.21
134 0.21
135 0.22
136 0.26
137 0.27
138 0.24
139 0.22
140 0.2
141 0.21
142 0.18
143 0.16
144 0.14
145 0.12
146 0.12
147 0.12
148 0.13
149 0.13
150 0.11
151 0.1
152 0.07
153 0.14
154 0.16
155 0.17
156 0.2
157 0.23
158 0.32
159 0.42
160 0.49
161 0.45
162 0.45
163 0.46
164 0.45
165 0.48
166 0.44
167 0.38
168 0.39
169 0.39
170 0.41
171 0.4
172 0.4
173 0.36
174 0.32
175 0.35
176 0.32
177 0.33
178 0.3
179 0.31
180 0.31