Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0UKB6

Protein Details
Accession A0A0L0UKB6   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MWLSMRREKRDRRPFKGMRFTPFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 11.5, cyto 6.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012591  PRO8NT  
IPR027652  PRP8  
Gene Ontology GO:0005681  C:spliceosomal complex  
GO:0000398  P:mRNA splicing, via spliceosome  
Pfam View protein in Pfam  
PF08082  PRO8NT  
Amino Acid Sequences MWLSMRREKRDRRPFKGMRFTPFDDEESPLDYGANILDTEPTEAIQTDLDEDADAPDLDWFYDHKPLTKKYKATNTSMAFFTAKAMNMAIPGGARFEPLHRDAESYDDDWNELNGINKVTF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.88
3 0.89
4 0.83
5 0.79
6 0.76
7 0.71
8 0.66
9 0.59
10 0.52
11 0.42
12 0.39
13 0.33
14 0.28
15 0.25
16 0.19
17 0.16
18 0.13
19 0.11
20 0.08
21 0.08
22 0.05
23 0.05
24 0.05
25 0.06
26 0.07
27 0.07
28 0.07
29 0.07
30 0.07
31 0.07
32 0.06
33 0.06
34 0.06
35 0.06
36 0.06
37 0.05
38 0.05
39 0.05
40 0.06
41 0.05
42 0.04
43 0.05
44 0.04
45 0.04
46 0.05
47 0.05
48 0.06
49 0.11
50 0.11
51 0.15
52 0.19
53 0.25
54 0.33
55 0.38
56 0.41
57 0.43
58 0.53
59 0.53
60 0.54
61 0.57
62 0.51
63 0.48
64 0.44
65 0.39
66 0.29
67 0.25
68 0.22
69 0.15
70 0.13
71 0.11
72 0.11
73 0.09
74 0.09
75 0.09
76 0.07
77 0.06
78 0.05
79 0.07
80 0.07
81 0.08
82 0.09
83 0.11
84 0.15
85 0.17
86 0.21
87 0.19
88 0.21
89 0.2
90 0.24
91 0.25
92 0.21
93 0.22
94 0.19
95 0.19
96 0.17
97 0.17
98 0.14
99 0.11
100 0.13
101 0.13