Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L0UXR5

Protein Details
Accession A0A0L0UXR5    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
144-170ITAVRVKIAKRPYRKRKVEYWQRFSTWHydrophilic
NLS Segment(s)
PositionSequence
138-160SSRPRRITAVRVKIAKRPYRKRK
Subcellular Location(s) mito 12, nucl 11.5, cyto_nucl 7, cyto 1.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR024991  RING-H2_APC11  
IPR013083  Znf_RING/FYVE/PHD  
Gene Ontology GO:0005680  C:anaphase-promoting complex  
GO:0097602  F:cullin family protein binding  
GO:0061630  F:ubiquitin protein ligase activity  
GO:0008270  F:zinc ion binding  
GO:0031145  P:anaphase-promoting complex-dependent catabolic process  
Pfam View protein in Pfam  
PF12861  zf-ANAPC11  
Amino Acid Sequences MRHRFHVSCIRVWFDEQLSQGYRRTCPLCRTTFPSAKMIARLPVENPPYSDRYMRNLARAHQLQLLELVSPAQPAVSVAQPRTSQTFSLIIPAVPRANIQRVSTVASHAATLPTRRSSPEDPAQVPTQLPKRSSPIASSRPRRITAVRVKIAKRPYRKRKVEYWQRFSTWPN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.34
3 0.28
4 0.29
5 0.27
6 0.28
7 0.3
8 0.29
9 0.28
10 0.3
11 0.33
12 0.34
13 0.38
14 0.44
15 0.46
16 0.48
17 0.53
18 0.57
19 0.59
20 0.57
21 0.54
22 0.5
23 0.45
24 0.44
25 0.38
26 0.34
27 0.29
28 0.27
29 0.24
30 0.28
31 0.29
32 0.27
33 0.27
34 0.27
35 0.28
36 0.29
37 0.31
38 0.26
39 0.28
40 0.35
41 0.34
42 0.36
43 0.36
44 0.36
45 0.4
46 0.4
47 0.37
48 0.32
49 0.3
50 0.24
51 0.23
52 0.21
53 0.12
54 0.11
55 0.09
56 0.06
57 0.06
58 0.06
59 0.04
60 0.04
61 0.04
62 0.05
63 0.07
64 0.09
65 0.09
66 0.13
67 0.13
68 0.14
69 0.17
70 0.17
71 0.14
72 0.15
73 0.16
74 0.13
75 0.15
76 0.14
77 0.11
78 0.11
79 0.12
80 0.1
81 0.08
82 0.09
83 0.09
84 0.12
85 0.15
86 0.15
87 0.15
88 0.16
89 0.19
90 0.18
91 0.17
92 0.15
93 0.13
94 0.12
95 0.11
96 0.12
97 0.1
98 0.12
99 0.13
100 0.14
101 0.15
102 0.17
103 0.22
104 0.24
105 0.3
106 0.36
107 0.39
108 0.38
109 0.41
110 0.41
111 0.36
112 0.33
113 0.32
114 0.32
115 0.3
116 0.3
117 0.3
118 0.33
119 0.36
120 0.38
121 0.37
122 0.38
123 0.44
124 0.52
125 0.57
126 0.62
127 0.63
128 0.64
129 0.63
130 0.58
131 0.58
132 0.59
133 0.61
134 0.59
135 0.6
136 0.61
137 0.63
138 0.7
139 0.69
140 0.69
141 0.7
142 0.74
143 0.78
144 0.85
145 0.85
146 0.86
147 0.88
148 0.89
149 0.89
150 0.86
151 0.83
152 0.77