Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0VB33

Protein Details
Accession A0A0L0VB33    Localization Confidence Low Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
3-22MTTTTSKKPSQAKKIKASALHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15.5, mito_nucl 12.5, nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029466  NAM-associated_C  
Pfam View protein in Pfam  
PF14303  NAM-associated  
Amino Acid Sequences MLMTTTTSKKPSQAKKIKASALTLFPTLPPTPLATSDAPTIQSTQTARAIGTKKAKDLAAKLQEDKKCKDDMLAVHPDLDNQTKSQNTILADQREALTTLANNSIMQTDLATVSETSRPSTSGNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.74
3 0.8
4 0.79
5 0.73
6 0.67
7 0.6
8 0.54
9 0.47
10 0.38
11 0.31
12 0.25
13 0.26
14 0.22
15 0.18
16 0.15
17 0.15
18 0.15
19 0.16
20 0.2
21 0.16
22 0.18
23 0.18
24 0.18
25 0.17
26 0.16
27 0.16
28 0.12
29 0.15
30 0.13
31 0.15
32 0.16
33 0.15
34 0.14
35 0.18
36 0.2
37 0.23
38 0.3
39 0.28
40 0.27
41 0.29
42 0.3
43 0.27
44 0.28
45 0.3
46 0.29
47 0.3
48 0.32
49 0.36
50 0.38
51 0.4
52 0.4
53 0.35
54 0.29
55 0.28
56 0.26
57 0.23
58 0.22
59 0.24
60 0.27
61 0.24
62 0.24
63 0.24
64 0.23
65 0.21
66 0.21
67 0.15
68 0.11
69 0.14
70 0.14
71 0.15
72 0.16
73 0.17
74 0.16
75 0.2
76 0.26
77 0.25
78 0.25
79 0.25
80 0.24
81 0.22
82 0.22
83 0.16
84 0.12
85 0.09
86 0.11
87 0.12
88 0.12
89 0.11
90 0.1
91 0.11
92 0.11
93 0.1
94 0.09
95 0.08
96 0.08
97 0.08
98 0.09
99 0.09
100 0.1
101 0.14
102 0.14
103 0.17
104 0.17
105 0.18