Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L0V9D4

Protein Details
Accession A0A0L0V9D4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MVKIPKLKTKSKRMIPVGNCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, extr 5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR017264  Ribosomal_MRP10_mt  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Amino Acid Sequences MVKIPKLKTKSKRMIPVGNCALELSGLLQCWATTSDVHSIGQCSDAAKNLSTCMKSAKTVNTTKTDSINFHLARLGKNFK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.76
3 0.76
4 0.7
5 0.61
6 0.52
7 0.42
8 0.34
9 0.24
10 0.21
11 0.12
12 0.07
13 0.06
14 0.06
15 0.06
16 0.06
17 0.07
18 0.08
19 0.07
20 0.06
21 0.08
22 0.11
23 0.12
24 0.12
25 0.12
26 0.11
27 0.1
28 0.11
29 0.09
30 0.07
31 0.07
32 0.09
33 0.1
34 0.1
35 0.1
36 0.11
37 0.14
38 0.14
39 0.14
40 0.16
41 0.17
42 0.19
43 0.22
44 0.26
45 0.3
46 0.35
47 0.39
48 0.41
49 0.43
50 0.43
51 0.44
52 0.41
53 0.37
54 0.35
55 0.4
56 0.34
57 0.31
58 0.33
59 0.31
60 0.31