Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0VZB5

Protein Details
Accession A0A0L0VZB5   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MAYPPRKRRRRSLTSLPPPSTQHydrophilic
NLS Segment(s)
PositionSequence
6-10RKRRR
Subcellular Location(s) nucl 23, cyto_nucl 13
Family & Domain DBs
Amino Acid Sequences MAYPPRKRRRRSLTSLPPPSTQEDNNNTDRSEIMTPISTQPQLATTPTVALSNEQELQRAVRIAANAISSSYQLYGTPELSDSLDKHQRQMISILARCSTTLRNLVCRGHKALFSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.9
3 0.83
4 0.75
5 0.68
6 0.63
7 0.55
8 0.47
9 0.44
10 0.41
11 0.42
12 0.44
13 0.43
14 0.38
15 0.34
16 0.32
17 0.27
18 0.22
19 0.17
20 0.14
21 0.13
22 0.14
23 0.16
24 0.18
25 0.15
26 0.14
27 0.13
28 0.13
29 0.13
30 0.13
31 0.12
32 0.09
33 0.1
34 0.1
35 0.1
36 0.09
37 0.09
38 0.09
39 0.09
40 0.12
41 0.11
42 0.11
43 0.11
44 0.11
45 0.11
46 0.1
47 0.09
48 0.07
49 0.07
50 0.07
51 0.08
52 0.08
53 0.08
54 0.08
55 0.08
56 0.07
57 0.07
58 0.07
59 0.06
60 0.06
61 0.08
62 0.09
63 0.09
64 0.09
65 0.09
66 0.1
67 0.1
68 0.12
69 0.11
70 0.17
71 0.25
72 0.24
73 0.26
74 0.29
75 0.29
76 0.28
77 0.29
78 0.28
79 0.28
80 0.3
81 0.3
82 0.28
83 0.27
84 0.26
85 0.27
86 0.24
87 0.21
88 0.25
89 0.25
90 0.31
91 0.36
92 0.42
93 0.46
94 0.49
95 0.5
96 0.46