Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L0UKH5

Protein Details
Accession A0A0L0UKH5    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
18-37ITKPRKLAPKIDRRNIRTYNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito 6, cyto 6, cyto_mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR036179  Ig-like_dom_sf  
IPR013783  Ig-like_fold  
IPR013098  Ig_I-set  
Pfam View protein in Pfam  
PF07679  I-set  
Amino Acid Sequences AINAAGPGEPSDASKSVITKPRKLAPKIDRRNIRTYNFKAGEPIYLDINVIGEPAPDVVWSQNGKSIQQSSQCRLENIPYNTKYIHGNPERKDTGLYKIVATNKYGQDTVEFEINIISKFYA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.24
4 0.33
5 0.37
6 0.4
7 0.45
8 0.51
9 0.58
10 0.59
11 0.63
12 0.64
13 0.7
14 0.73
15 0.77
16 0.78
17 0.75
18 0.81
19 0.77
20 0.72
21 0.71
22 0.65
23 0.65
24 0.58
25 0.52
26 0.46
27 0.4
28 0.36
29 0.29
30 0.25
31 0.16
32 0.14
33 0.13
34 0.1
35 0.1
36 0.08
37 0.06
38 0.05
39 0.03
40 0.03
41 0.04
42 0.04
43 0.03
44 0.04
45 0.04
46 0.07
47 0.08
48 0.08
49 0.11
50 0.11
51 0.12
52 0.13
53 0.15
54 0.15
55 0.22
56 0.26
57 0.26
58 0.33
59 0.33
60 0.32
61 0.31
62 0.33
63 0.34
64 0.35
65 0.39
66 0.33
67 0.34
68 0.33
69 0.34
70 0.33
71 0.27
72 0.33
73 0.33
74 0.39
75 0.4
76 0.48
77 0.49
78 0.46
79 0.47
80 0.39
81 0.37
82 0.35
83 0.33
84 0.26
85 0.29
86 0.34
87 0.32
88 0.33
89 0.33
90 0.3
91 0.32
92 0.31
93 0.27
94 0.24
95 0.25
96 0.25
97 0.23
98 0.2
99 0.17
100 0.19
101 0.19
102 0.17