Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0VVS2

Protein Details
Accession A0A0L0VVS2   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
54-84KTGVLRKWKLDKKNEAKRKGKGKATRNQIGWHydrophilic
NLS Segment(s)
PositionSequence
52-77KIKTGVLRKWKLDKKNEAKRKGKGKA
Subcellular Location(s) mito 17, cyto 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR008906  HATC_C_dom  
Gene Ontology GO:0046983  F:protein dimerization activity  
Pfam View protein in Pfam  
PF05699  Dimer_Tnp_hAT  
Amino Acid Sequences MALDVLSCPATTVDVERSFSFGRDYVSLGRHCLSATSVTWGMAVAFYAKNGKIKTGVLRKWKLDKKNEAKRKGKGKATRNQIGWGFC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.2
3 0.2
4 0.23
5 0.23
6 0.23
7 0.22
8 0.17
9 0.17
10 0.15
11 0.17
12 0.16
13 0.2
14 0.2
15 0.2
16 0.2
17 0.18
18 0.17
19 0.15
20 0.13
21 0.11
22 0.11
23 0.13
24 0.12
25 0.12
26 0.12
27 0.11
28 0.1
29 0.08
30 0.07
31 0.05
32 0.04
33 0.05
34 0.07
35 0.07
36 0.11
37 0.11
38 0.12
39 0.13
40 0.15
41 0.22
42 0.3
43 0.35
44 0.41
45 0.46
46 0.5
47 0.58
48 0.65
49 0.65
50 0.65
51 0.7
52 0.72
53 0.78
54 0.83
55 0.84
56 0.84
57 0.85
58 0.86
59 0.84
60 0.83
61 0.81
62 0.81
63 0.79
64 0.81
65 0.81
66 0.73
67 0.71