Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0V3Z6

Protein Details
Accession A0A0L0V3Z6   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
42-67GKAQKSTSSKKPKGKKKVLPPTEKNQHydrophilic
NLS Segment(s)
PositionSequence
42-59GKAQKSTSSKKPKGKKKV
Subcellular Location(s) nucl 16.5, cyto_nucl 14.333, mito_nucl 10.332, cyto 8
Family & Domain DBs
Amino Acid Sequences MGVEQDIMGNFDLLESFLAGSRPSGGIKIEKGPSEQKGEQLGKAQKSTSSKKPKGKKKVLPPTEKNQENGVNEEVTLPVEISVGSNPSLAESSVGQMFKEIFSHPERFAVQAIDQSWERYKAPSTSKLNEPNQETRSIN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.05
3 0.05
4 0.06
5 0.07
6 0.07
7 0.07
8 0.09
9 0.09
10 0.1
11 0.1
12 0.12
13 0.14
14 0.17
15 0.22
16 0.24
17 0.24
18 0.27
19 0.3
20 0.32
21 0.36
22 0.35
23 0.32
24 0.37
25 0.37
26 0.35
27 0.38
28 0.4
29 0.35
30 0.36
31 0.33
32 0.29
33 0.34
34 0.39
35 0.41
36 0.47
37 0.52
38 0.6
39 0.69
40 0.75
41 0.8
42 0.84
43 0.83
44 0.83
45 0.85
46 0.86
47 0.86
48 0.82
49 0.79
50 0.78
51 0.72
52 0.62
53 0.55
54 0.49
55 0.4
56 0.37
57 0.29
58 0.2
59 0.18
60 0.17
61 0.13
62 0.09
63 0.08
64 0.05
65 0.04
66 0.04
67 0.04
68 0.04
69 0.04
70 0.05
71 0.05
72 0.06
73 0.05
74 0.06
75 0.07
76 0.06
77 0.07
78 0.06
79 0.07
80 0.1
81 0.1
82 0.09
83 0.1
84 0.1
85 0.1
86 0.11
87 0.1
88 0.11
89 0.15
90 0.19
91 0.19
92 0.22
93 0.22
94 0.22
95 0.23
96 0.21
97 0.18
98 0.18
99 0.18
100 0.18
101 0.18
102 0.2
103 0.21
104 0.22
105 0.22
106 0.21
107 0.24
108 0.27
109 0.32
110 0.39
111 0.43
112 0.46
113 0.54
114 0.62
115 0.65
116 0.66
117 0.67
118 0.66
119 0.61