Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C6HEK9

Protein Details
Accession C6HEK9   
Localization Confidence High
Confidence Score 17.7
NoLS Segment(s)
PositionSequenceProtein Nature
21-45AQLKRFEKDKALKEKYKKHPPWSAEHydrophilic
136-165FEGKKRTAWLSPRRPRQKRQPPPGEPPGVFHydrophilic
NLS Segment(s)
PositionSequence
19-41RRAQLKRFEKDKALKEKYKKHPP
140-156KRTAWLSPRRPRQKRQP
Subcellular Location(s) nucl 22, cyto_nucl 13.5, cyto 3
Family & Domain DBs
Amino Acid Sequences MSTLELSSSSLKKLEEEARRAQLKRFEKDKALKEKYKKHPPWSAEDWQRAKAAPPRPPVRYPVIISSSGTFPTAEKVKEVANLPSVPEVLWTTMTTMFDSEPEPEEPEKVQYCVLDFDALQLIEKYAKGEDVAIWFEGKKRTAWLSPRRPRQKRQPPPGEPPGVFAPAFDDDSSTEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.35
3 0.4
4 0.45
5 0.51
6 0.58
7 0.58
8 0.57
9 0.58
10 0.58
11 0.61
12 0.59
13 0.56
14 0.58
15 0.66
16 0.69
17 0.71
18 0.72
19 0.71
20 0.75
21 0.8
22 0.82
23 0.84
24 0.83
25 0.81
26 0.8
27 0.75
28 0.75
29 0.71
30 0.7
31 0.67
32 0.68
33 0.62
34 0.56
35 0.54
36 0.46
37 0.42
38 0.4
39 0.39
40 0.37
41 0.43
42 0.47
43 0.51
44 0.53
45 0.53
46 0.52
47 0.49
48 0.44
49 0.4
50 0.37
51 0.33
52 0.31
53 0.28
54 0.23
55 0.19
56 0.17
57 0.12
58 0.09
59 0.11
60 0.14
61 0.12
62 0.12
63 0.12
64 0.13
65 0.15
66 0.17
67 0.15
68 0.15
69 0.15
70 0.14
71 0.14
72 0.13
73 0.1
74 0.1
75 0.09
76 0.06
77 0.07
78 0.06
79 0.07
80 0.08
81 0.09
82 0.08
83 0.08
84 0.08
85 0.08
86 0.08
87 0.08
88 0.09
89 0.1
90 0.12
91 0.12
92 0.13
93 0.13
94 0.16
95 0.16
96 0.14
97 0.14
98 0.12
99 0.13
100 0.13
101 0.13
102 0.1
103 0.09
104 0.09
105 0.1
106 0.1
107 0.1
108 0.08
109 0.08
110 0.08
111 0.09
112 0.09
113 0.07
114 0.07
115 0.07
116 0.08
117 0.09
118 0.1
119 0.11
120 0.11
121 0.11
122 0.11
123 0.14
124 0.17
125 0.17
126 0.16
127 0.18
128 0.22
129 0.28
130 0.37
131 0.45
132 0.53
133 0.62
134 0.72
135 0.8
136 0.84
137 0.87
138 0.89
139 0.9
140 0.9
141 0.91
142 0.91
143 0.88
144 0.89
145 0.89
146 0.85
147 0.74
148 0.67
149 0.6
150 0.52
151 0.43
152 0.34
153 0.28
154 0.23
155 0.25
156 0.2
157 0.17