Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0VZ68

Protein Details
Accession A0A0L0VZ68   
Localization Confidence Low
Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
53-79QKLRWATRLRPKKRNYKCPPNTRAQCCHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 10, nucl 6, mito 5, plas 3, cyto_nucl 3
Family & Domain DBs
Amino Acid Sequences MLRFLRLTALVLLVASWQVTDTLNQDPGDILFWCRKNVDAVCAETILPDGGEQKLRWATRLRPKKRNYKCPPNTRAQCCWQNWYKDISNGPDYFMKIASGPVPYCDPNGQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.06
3 0.05
4 0.04
5 0.05
6 0.06
7 0.07
8 0.09
9 0.12
10 0.15
11 0.15
12 0.15
13 0.15
14 0.15
15 0.15
16 0.13
17 0.13
18 0.15
19 0.17
20 0.18
21 0.18
22 0.18
23 0.21
24 0.21
25 0.24
26 0.2
27 0.21
28 0.2
29 0.2
30 0.19
31 0.15
32 0.14
33 0.1
34 0.07
35 0.05
36 0.05
37 0.06
38 0.07
39 0.07
40 0.09
41 0.14
42 0.14
43 0.16
44 0.18
45 0.25
46 0.33
47 0.44
48 0.5
49 0.56
50 0.63
51 0.72
52 0.79
53 0.83
54 0.83
55 0.84
56 0.85
57 0.87
58 0.85
59 0.85
60 0.84
61 0.79
62 0.75
63 0.72
64 0.7
65 0.61
66 0.63
67 0.58
68 0.54
69 0.5
70 0.5
71 0.45
72 0.41
73 0.42
74 0.41
75 0.4
76 0.36
77 0.36
78 0.33
79 0.31
80 0.28
81 0.25
82 0.2
83 0.14
84 0.15
85 0.15
86 0.16
87 0.15
88 0.16
89 0.2
90 0.21