Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L0VNQ5

Protein Details
Accession A0A0L0VNQ5    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MAKSKNHTNHNQNKKAHRNGIHRPLRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, mito 5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNHTNHNQNKKAHRNGIHRPLRCRYPSLKGVDPKFRRNQKFAKHGTQKALAAARASEKEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.83
3 0.81
4 0.79
5 0.76
6 0.77
7 0.8
8 0.79
9 0.73
10 0.71
11 0.67
12 0.65
13 0.59
14 0.54
15 0.47
16 0.45
17 0.47
18 0.46
19 0.47
20 0.46
21 0.48
22 0.54
23 0.54
24 0.55
25 0.57
26 0.62
27 0.62
28 0.62
29 0.67
30 0.66
31 0.71
32 0.71
33 0.72
34 0.72
35 0.72
36 0.71
37 0.67
38 0.59
39 0.54
40 0.51
41 0.41
42 0.33
43 0.29
44 0.28