Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0VXK9

Protein Details
Accession A0A0L0VXK9   
Localization Confidence High
Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
94-135LGAANQKQKKPQLRKRRHPLVRMIWLKKKAQPRRKLLTNVVIHydrophilic
NLS Segment(s)
PositionSequence
98-128NQKQKKPQLRKRRHPLVRMIWLKKKAQPRRK
Subcellular Location(s) nucl 23, cyto 2
Family & Domain DBs
Amino Acid Sequences MAETDSESKSSSSPPPNNTPNIIQYPYPPGWISPPPNNTPNIIQYLESLHPPIYHNFIQSCLTNFLRLVLLQLVLQPQAASPPWFHTKPKAAELGAANQKQKKPQLRKRRHPLVRMIWLKKKAQPRRKLLTNVVILQSPSNNQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.5
3 0.55
4 0.58
5 0.58
6 0.54
7 0.5
8 0.49
9 0.45
10 0.36
11 0.33
12 0.36
13 0.33
14 0.32
15 0.26
16 0.21
17 0.23
18 0.29
19 0.32
20 0.32
21 0.37
22 0.4
23 0.42
24 0.43
25 0.41
26 0.38
27 0.35
28 0.32
29 0.27
30 0.23
31 0.2
32 0.23
33 0.21
34 0.18
35 0.16
36 0.13
37 0.13
38 0.14
39 0.15
40 0.16
41 0.16
42 0.17
43 0.16
44 0.18
45 0.18
46 0.17
47 0.18
48 0.17
49 0.17
50 0.16
51 0.15
52 0.14
53 0.13
54 0.12
55 0.11
56 0.07
57 0.07
58 0.06
59 0.07
60 0.07
61 0.06
62 0.06
63 0.05
64 0.05
65 0.06
66 0.06
67 0.07
68 0.07
69 0.11
70 0.16
71 0.18
72 0.19
73 0.23
74 0.3
75 0.33
76 0.35
77 0.35
78 0.3
79 0.32
80 0.32
81 0.34
82 0.34
83 0.34
84 0.34
85 0.35
86 0.37
87 0.39
88 0.46
89 0.49
90 0.52
91 0.6
92 0.68
93 0.75
94 0.84
95 0.89
96 0.92
97 0.91
98 0.87
99 0.86
100 0.84
101 0.83
102 0.82
103 0.79
104 0.76
105 0.73
106 0.71
107 0.67
108 0.69
109 0.69
110 0.7
111 0.72
112 0.73
113 0.77
114 0.82
115 0.83
116 0.81
117 0.79
118 0.75
119 0.69
120 0.61
121 0.53
122 0.45
123 0.39