Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0VIT9

Protein Details
Accession A0A0L0VIT9   
Localization Confidence Low
Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
126-145SSSSSFKRDRDRPSDRERDSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto_nucl 14.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR012479  SAP30BP  
Gene Ontology GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF07818  HCNGP  
Amino Acid Sequences MTEQEQPPLPDLDPDLIKKIDRFKSLQEQGIYFNDNLIASKSYRNPNIHPKLVEFLNVNQNSTNFDLKYWNPLGFPKDAYSDSIRLAQQDLADQKEKQRTSSVNNNKRSFIEFESQRNTSSSVNKSSSSSFKRDRDRPSDRERDSTAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.25
3 0.24
4 0.25
5 0.26
6 0.33
7 0.35
8 0.37
9 0.38
10 0.4
11 0.49
12 0.53
13 0.56
14 0.49
15 0.44
16 0.43
17 0.42
18 0.38
19 0.28
20 0.22
21 0.17
22 0.15
23 0.15
24 0.13
25 0.12
26 0.1
27 0.15
28 0.2
29 0.25
30 0.32
31 0.35
32 0.38
33 0.47
34 0.54
35 0.54
36 0.49
37 0.45
38 0.41
39 0.38
40 0.35
41 0.26
42 0.21
43 0.27
44 0.26
45 0.25
46 0.22
47 0.22
48 0.22
49 0.23
50 0.22
51 0.13
52 0.13
53 0.15
54 0.15
55 0.21
56 0.19
57 0.17
58 0.16
59 0.18
60 0.2
61 0.17
62 0.18
63 0.13
64 0.14
65 0.14
66 0.16
67 0.17
68 0.16
69 0.16
70 0.18
71 0.17
72 0.15
73 0.16
74 0.14
75 0.12
76 0.14
77 0.15
78 0.15
79 0.17
80 0.17
81 0.21
82 0.28
83 0.28
84 0.27
85 0.3
86 0.29
87 0.34
88 0.44
89 0.5
90 0.52
91 0.61
92 0.61
93 0.59
94 0.57
95 0.54
96 0.47
97 0.4
98 0.4
99 0.35
100 0.38
101 0.42
102 0.41
103 0.39
104 0.36
105 0.34
106 0.29
107 0.32
108 0.31
109 0.32
110 0.34
111 0.34
112 0.35
113 0.37
114 0.42
115 0.41
116 0.44
117 0.46
118 0.52
119 0.6
120 0.66
121 0.71
122 0.72
123 0.76
124 0.76
125 0.78
126 0.8
127 0.75
128 0.74