Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0UPE5

Protein Details
Accession A0A0L0UPE5   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
18-46ELPPLNQPQNVKKPKKNKQTKGLETPTHAHydrophilic
NLS Segment(s)
PositionSequence
31-33PKK
Subcellular Location(s) nucl 18.5, cyto_nucl 12, cyto 4.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR039024  RTC4  
Amino Acid Sequences MAKLSLLELLSFRYKLDELPPLNQPQNVKKPKKNKQTKGLETPTHAPSVGTSRKRLKTLLAPISPSLVPATQPTPGPKTQEQDLITLPVTESNTGPVYEDTWPPLEPKRSESPRGETSITDSKALTSLEATDLPPGVQPPLDILKDMTNLLTSRGLSLQTPTSDEMIHPAFRGTSNTGSGLTASQLQLLKDLEDLEEPQLQTATSGFVCPFCYEQLPDHHSDELKALYEYFKKESRGFTVKLPWPRTAGYCSMHTKEFELIPMGRARGWPIEMDWVTLPSRVKPLSPHLWSVAKQRTPSVFLAPALQRWKTLGPSKANSSYHNLDDFRVEIPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.2
3 0.24
4 0.29
5 0.28
6 0.32
7 0.38
8 0.42
9 0.44
10 0.45
11 0.45
12 0.46
13 0.54
14 0.61
15 0.64
16 0.67
17 0.75
18 0.83
19 0.89
20 0.9
21 0.89
22 0.89
23 0.91
24 0.91
25 0.91
26 0.89
27 0.82
28 0.77
29 0.72
30 0.64
31 0.54
32 0.45
33 0.34
34 0.27
35 0.31
36 0.34
37 0.33
38 0.38
39 0.45
40 0.5
41 0.53
42 0.53
43 0.5
44 0.5
45 0.56
46 0.58
47 0.52
48 0.49
49 0.46
50 0.48
51 0.42
52 0.34
53 0.26
54 0.17
55 0.14
56 0.14
57 0.15
58 0.14
59 0.16
60 0.2
61 0.23
62 0.25
63 0.31
64 0.32
65 0.34
66 0.35
67 0.4
68 0.37
69 0.34
70 0.33
71 0.29
72 0.25
73 0.22
74 0.19
75 0.15
76 0.14
77 0.13
78 0.12
79 0.12
80 0.12
81 0.12
82 0.13
83 0.11
84 0.12
85 0.13
86 0.14
87 0.14
88 0.14
89 0.15
90 0.16
91 0.2
92 0.24
93 0.23
94 0.28
95 0.36
96 0.4
97 0.46
98 0.48
99 0.5
100 0.48
101 0.51
102 0.46
103 0.36
104 0.37
105 0.38
106 0.34
107 0.29
108 0.24
109 0.21
110 0.21
111 0.21
112 0.15
113 0.08
114 0.08
115 0.08
116 0.09
117 0.09
118 0.08
119 0.08
120 0.08
121 0.08
122 0.08
123 0.07
124 0.06
125 0.06
126 0.07
127 0.1
128 0.1
129 0.1
130 0.11
131 0.12
132 0.13
133 0.13
134 0.11
135 0.09
136 0.09
137 0.1
138 0.1
139 0.09
140 0.09
141 0.09
142 0.1
143 0.08
144 0.1
145 0.1
146 0.09
147 0.11
148 0.11
149 0.11
150 0.11
151 0.1
152 0.12
153 0.11
154 0.11
155 0.09
156 0.09
157 0.08
158 0.09
159 0.11
160 0.1
161 0.1
162 0.11
163 0.11
164 0.12
165 0.11
166 0.11
167 0.09
168 0.08
169 0.08
170 0.07
171 0.09
172 0.1
173 0.1
174 0.11
175 0.11
176 0.11
177 0.1
178 0.1
179 0.08
180 0.07
181 0.08
182 0.08
183 0.11
184 0.1
185 0.1
186 0.1
187 0.09
188 0.09
189 0.08
190 0.08
191 0.05
192 0.06
193 0.06
194 0.07
195 0.08
196 0.09
197 0.1
198 0.09
199 0.11
200 0.11
201 0.14
202 0.2
203 0.23
204 0.25
205 0.26
206 0.27
207 0.25
208 0.25
209 0.24
210 0.18
211 0.15
212 0.12
213 0.11
214 0.12
215 0.15
216 0.17
217 0.19
218 0.22
219 0.24
220 0.27
221 0.29
222 0.34
223 0.37
224 0.36
225 0.36
226 0.42
227 0.44
228 0.5
229 0.51
230 0.46
231 0.42
232 0.42
233 0.41
234 0.36
235 0.34
236 0.29
237 0.31
238 0.34
239 0.34
240 0.34
241 0.32
242 0.3
243 0.28
244 0.26
245 0.21
246 0.2
247 0.18
248 0.18
249 0.2
250 0.19
251 0.17
252 0.17
253 0.19
254 0.17
255 0.18
256 0.16
257 0.14
258 0.22
259 0.22
260 0.23
261 0.21
262 0.21
263 0.2
264 0.23
265 0.23
266 0.16
267 0.22
268 0.21
269 0.22
270 0.24
271 0.31
272 0.38
273 0.4
274 0.41
275 0.4
276 0.44
277 0.45
278 0.5
279 0.51
280 0.47
281 0.45
282 0.47
283 0.46
284 0.46
285 0.46
286 0.42
287 0.36
288 0.32
289 0.37
290 0.33
291 0.36
292 0.36
293 0.35
294 0.3
295 0.3
296 0.33
297 0.33
298 0.39
299 0.41
300 0.44
301 0.49
302 0.55
303 0.61
304 0.6
305 0.57
306 0.57
307 0.54
308 0.5
309 0.5
310 0.44
311 0.36
312 0.36
313 0.34