Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0V6G1

Protein Details
Accession A0A0L0V6G1    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
79-104KEKEKEKVVASKKKKNTNNNLEDKVEHydrophilic
NLS Segment(s)
PositionSequence
46-93KQKEEEEKKKIEIKKAKKAEEKAQEKEKEREMEKEKEKEKVVASKKKK
Subcellular Location(s) nucl 20, cyto_nucl 12.833, mito_nucl 11.333, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MKSALQDASNEAILSKDLDSTSGQKQRFYERKLQLIFDQEDALEKKQKEEEEKKKIEIKKAKKAEEKAQEKEKEREMEKEKEKEKVVASKKKKNTNNNLEDKVEIEFE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.1
3 0.09
4 0.09
5 0.1
6 0.12
7 0.15
8 0.23
9 0.29
10 0.29
11 0.3
12 0.33
13 0.42
14 0.48
15 0.49
16 0.51
17 0.5
18 0.57
19 0.56
20 0.56
21 0.48
22 0.46
23 0.42
24 0.33
25 0.28
26 0.19
27 0.21
28 0.2
29 0.19
30 0.19
31 0.17
32 0.18
33 0.21
34 0.23
35 0.29
36 0.37
37 0.45
38 0.49
39 0.52
40 0.53
41 0.57
42 0.58
43 0.58
44 0.57
45 0.56
46 0.56
47 0.62
48 0.66
49 0.66
50 0.68
51 0.68
52 0.69
53 0.68
54 0.64
55 0.65
56 0.64
57 0.62
58 0.61
59 0.58
60 0.54
61 0.49
62 0.51
63 0.49
64 0.51
65 0.54
66 0.58
67 0.55
68 0.55
69 0.55
70 0.5
71 0.49
72 0.49
73 0.51
74 0.53
75 0.6
76 0.64
77 0.71
78 0.77
79 0.82
80 0.83
81 0.84
82 0.85
83 0.86
84 0.86
85 0.82
86 0.75
87 0.66
88 0.57