Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0UIE8

Protein Details
Accession A0A0L0UIE8    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
35-54CSAFPKCRYIQKQLEKIKPCHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 11.5, nucl 9, mito 8, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR013498  Topo_IA_Znf  
Gene Ontology GO:0005694  C:chromosome  
GO:0003677  F:DNA binding  
GO:0003916  F:DNA topoisomerase activity  
GO:0006265  P:DNA topological change  
Pfam View protein in Pfam  
PF01396  zf-C4_Topoisom  
Amino Acid Sequences MTEFKIKPVLLDQDCPLCGAPLVQRTGRYGKFNGCSAFPKCRYIQKQLEKIKPCL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.31
3 0.26
4 0.17
5 0.14
6 0.12
7 0.13
8 0.13
9 0.16
10 0.16
11 0.17
12 0.2
13 0.25
14 0.26
15 0.26
16 0.24
17 0.26
18 0.27
19 0.29
20 0.28
21 0.25
22 0.27
23 0.28
24 0.35
25 0.33
26 0.35
27 0.36
28 0.44
29 0.48
30 0.53
31 0.59
32 0.61
33 0.68
34 0.74
35 0.8