Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0VD49

Protein Details
Accession A0A0L0VD49   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
74-99LVKNKDQFKQLKKNDTQKRKACPGSTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto_nucl 13.333, cyto 5.5, cyto_mito 3.666
Family & Domain DBs
Amino Acid Sequences FGVFKDLDGSLERSRFGDIQILTIDYISLPGSHSLLPNLSIGLILYWYRLTNPLHYMQNFSNEEDFVKFMIDLLVKNKDQFKQLKKNDTQKRKACPGSTSQPNTKKAKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.22
3 0.21
4 0.22
5 0.18
6 0.19
7 0.19
8 0.19
9 0.16
10 0.15
11 0.14
12 0.08
13 0.08
14 0.06
15 0.05
16 0.05
17 0.06
18 0.08
19 0.08
20 0.09
21 0.09
22 0.09
23 0.1
24 0.09
25 0.09
26 0.07
27 0.06
28 0.06
29 0.05
30 0.05
31 0.04
32 0.04
33 0.05
34 0.05
35 0.05
36 0.09
37 0.1
38 0.11
39 0.14
40 0.17
41 0.2
42 0.2
43 0.23
44 0.2
45 0.26
46 0.25
47 0.24
48 0.21
49 0.18
50 0.18
51 0.16
52 0.16
53 0.09
54 0.08
55 0.07
56 0.06
57 0.08
58 0.08
59 0.08
60 0.11
61 0.15
62 0.15
63 0.18
64 0.22
65 0.23
66 0.29
67 0.36
68 0.42
69 0.48
70 0.56
71 0.64
72 0.68
73 0.77
74 0.81
75 0.84
76 0.85
77 0.82
78 0.83
79 0.83
80 0.81
81 0.75
82 0.69
83 0.66
84 0.66
85 0.68
86 0.66
87 0.66
88 0.67
89 0.72