Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L0UMA6

Protein Details
Accession A0A0L0UMA6    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
133-159VKKVTTTKVEKPSKKPTVKKTVTPAKEHydrophilic
NLS Segment(s)
PositionSequence
82-101SKKTKKVAKVDDKKDIKVKT
111-152SDKIAKKEVTEKTTKAKSSNKEVKKVTTTKVEKPSKKPTVKK
Subcellular Location(s) nucl 15.5, cyto_nucl 13.333, mito_nucl 9.666, cyto 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MQVIKNKSTLELQQHEETLRAQLFALRIQSSLGKLETPHMINNLRKDIARIKTELTIRINNGEKIKPLHINKMVLPEENKESKKTKKVAKVDDKKDIKVKTITKSEVIKESDKIAKKEVTEKTTKAKSSNKEVKKVTTTKVEKPSKKPTVKKTVTPAKEDKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.4
3 0.37
4 0.32
5 0.28
6 0.23
7 0.18
8 0.15
9 0.16
10 0.16
11 0.17
12 0.2
13 0.15
14 0.15
15 0.16
16 0.18
17 0.16
18 0.17
19 0.16
20 0.13
21 0.13
22 0.16
23 0.19
24 0.19
25 0.19
26 0.21
27 0.26
28 0.28
29 0.32
30 0.34
31 0.31
32 0.29
33 0.31
34 0.34
35 0.34
36 0.34
37 0.31
38 0.28
39 0.32
40 0.34
41 0.36
42 0.32
43 0.29
44 0.28
45 0.31
46 0.32
47 0.3
48 0.31
49 0.27
50 0.25
51 0.24
52 0.26
53 0.29
54 0.28
55 0.32
56 0.33
57 0.34
58 0.33
59 0.37
60 0.35
61 0.29
62 0.29
63 0.23
64 0.24
65 0.27
66 0.27
67 0.23
68 0.27
69 0.31
70 0.37
71 0.41
72 0.44
73 0.48
74 0.55
75 0.62
76 0.68
77 0.73
78 0.71
79 0.75
80 0.71
81 0.65
82 0.63
83 0.54
84 0.47
85 0.44
86 0.43
87 0.39
88 0.43
89 0.41
90 0.4
91 0.42
92 0.4
93 0.39
94 0.38
95 0.34
96 0.29
97 0.31
98 0.33
99 0.35
100 0.34
101 0.32
102 0.31
103 0.31
104 0.38
105 0.4
106 0.39
107 0.4
108 0.41
109 0.45
110 0.49
111 0.5
112 0.48
113 0.5
114 0.5
115 0.56
116 0.64
117 0.63
118 0.65
119 0.65
120 0.66
121 0.67
122 0.66
123 0.59
124 0.6
125 0.58
126 0.59
127 0.66
128 0.69
129 0.68
130 0.72
131 0.78
132 0.78
133 0.82
134 0.83
135 0.83
136 0.84
137 0.83
138 0.82
139 0.81
140 0.82
141 0.77
142 0.76