Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L0VGI3

Protein Details
Accession A0A0L0VGI3    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
77-96IERHQHRIQKQLQHQPQPNKHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 15.5, cyto 13, nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR013126  Hsp_70_fam  
Gene Ontology GO:0005524  F:ATP binding  
GO:0140662  F:ATP-dependent protein folding chaperone  
Pfam View protein in Pfam  
PF00012  HSP70  
Amino Acid Sequences MALTKLCHGPHQAQGDYQDQRLLAKDAGAITGLDVLHIINKPTTASIAYSFGMASDQKEKKKQAILISDLGGCTFDIERHQHRIQKQLQHQPQPNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.41
3 0.39
4 0.35
5 0.3
6 0.23
7 0.23
8 0.23
9 0.21
10 0.15
11 0.13
12 0.13
13 0.12
14 0.12
15 0.11
16 0.09
17 0.07
18 0.08
19 0.08
20 0.06
21 0.06
22 0.05
23 0.07
24 0.07
25 0.08
26 0.06
27 0.07
28 0.07
29 0.07
30 0.08
31 0.06
32 0.07
33 0.07
34 0.09
35 0.09
36 0.09
37 0.08
38 0.08
39 0.08
40 0.07
41 0.08
42 0.14
43 0.19
44 0.22
45 0.28
46 0.3
47 0.33
48 0.38
49 0.41
50 0.39
51 0.41
52 0.41
53 0.38
54 0.38
55 0.34
56 0.29
57 0.24
58 0.19
59 0.12
60 0.1
61 0.08
62 0.07
63 0.11
64 0.16
65 0.21
66 0.28
67 0.33
68 0.38
69 0.42
70 0.51
71 0.55
72 0.59
73 0.65
74 0.68
75 0.73
76 0.77