Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0V3Z8

Protein Details
Accession A0A0L0V3Z8   
Localization Confidence High
Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
5-30EVNTRETKAKTPKPKKTQTAPNTPSTHydrophilic
NLS Segment(s)
PositionSequence
65-69AKKKR
Subcellular Location(s) nucl 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR029466  NAM-associated_C  
Pfam View protein in Pfam  
PF14303  NAM-associated  
Amino Acid Sequences MARDEVNTRETKAKTPKPKKTQTAPNTPSTSANRASSPVTIDIENEETSELSTLGNERMEGQKAAKKKRADNRSMGKIVHMQKELVQISRERLETMKSALQDASDEAILSKDLDSMSGQKRRYYERKLQLIFDREDALEKKQKEEEEKKKIEIEKAKDNNLEDEAGIEFE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.69
3 0.77
4 0.8
5 0.88
6 0.89
7 0.88
8 0.9
9 0.87
10 0.88
11 0.82
12 0.8
13 0.73
14 0.66
15 0.62
16 0.55
17 0.51
18 0.43
19 0.4
20 0.33
21 0.31
22 0.31
23 0.26
24 0.24
25 0.21
26 0.19
27 0.17
28 0.16
29 0.17
30 0.18
31 0.16
32 0.14
33 0.12
34 0.1
35 0.1
36 0.1
37 0.08
38 0.05
39 0.05
40 0.06
41 0.07
42 0.07
43 0.07
44 0.08
45 0.1
46 0.12
47 0.13
48 0.14
49 0.17
50 0.23
51 0.3
52 0.35
53 0.38
54 0.44
55 0.53
56 0.6
57 0.62
58 0.64
59 0.65
60 0.66
61 0.64
62 0.56
63 0.48
64 0.45
65 0.44
66 0.39
67 0.32
68 0.25
69 0.24
70 0.3
71 0.29
72 0.23
73 0.2
74 0.16
75 0.17
76 0.2
77 0.18
78 0.14
79 0.13
80 0.14
81 0.14
82 0.16
83 0.16
84 0.13
85 0.14
86 0.13
87 0.13
88 0.12
89 0.11
90 0.09
91 0.07
92 0.07
93 0.06
94 0.06
95 0.06
96 0.06
97 0.05
98 0.06
99 0.05
100 0.06
101 0.07
102 0.12
103 0.19
104 0.24
105 0.26
106 0.27
107 0.31
108 0.38
109 0.46
110 0.49
111 0.52
112 0.56
113 0.65
114 0.64
115 0.66
116 0.65
117 0.62
118 0.56
119 0.47
120 0.4
121 0.3
122 0.32
123 0.29
124 0.28
125 0.29
126 0.28
127 0.31
128 0.33
129 0.37
130 0.43
131 0.52
132 0.57
133 0.6
134 0.64
135 0.64
136 0.66
137 0.66
138 0.65
139 0.63
140 0.59
141 0.59
142 0.6
143 0.63
144 0.61
145 0.59
146 0.54
147 0.47
148 0.41
149 0.3
150 0.25