Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0VX18

Protein Details
Accession A0A0L0VX18    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
71-99ESSTKSPCLSARRKRRHQRSHFQDPGRRSHydrophilic
NLS Segment(s)
PositionSequence
82-88RRKRRHQ
Subcellular Location(s) mito 10, extr 7, cyto_nucl 7, nucl 5, cyto 5
Family & Domain DBs
Amino Acid Sequences MASIVHLIVAEGVRSTTIQSSVDLVHLSTSSSRYGVEAGEHAVLGGRTPLSLIQAHVPSVSSEATVRTGGESSTKSPCLSARRKRRHQRSHFQDPGRRSVRIQDGKPSGALPARGSQGFHAPII
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.08
4 0.1
5 0.1
6 0.11
7 0.12
8 0.12
9 0.13
10 0.12
11 0.11
12 0.1
13 0.09
14 0.1
15 0.09
16 0.1
17 0.1
18 0.1
19 0.1
20 0.09
21 0.1
22 0.1
23 0.09
24 0.08
25 0.09
26 0.09
27 0.08
28 0.07
29 0.07
30 0.07
31 0.06
32 0.06
33 0.04
34 0.04
35 0.04
36 0.05
37 0.06
38 0.07
39 0.07
40 0.1
41 0.11
42 0.11
43 0.11
44 0.11
45 0.09
46 0.1
47 0.09
48 0.06
49 0.06
50 0.06
51 0.07
52 0.07
53 0.07
54 0.06
55 0.07
56 0.06
57 0.08
58 0.09
59 0.1
60 0.13
61 0.15
62 0.14
63 0.15
64 0.19
65 0.25
66 0.34
67 0.42
68 0.5
69 0.6
70 0.71
71 0.81
72 0.88
73 0.91
74 0.91
75 0.92
76 0.91
77 0.91
78 0.89
79 0.86
80 0.82
81 0.75
82 0.74
83 0.67
84 0.59
85 0.49
86 0.47
87 0.5
88 0.52
89 0.5
90 0.49
91 0.5
92 0.5
93 0.5
94 0.42
95 0.35
96 0.3
97 0.3
98 0.23
99 0.23
100 0.25
101 0.25
102 0.26
103 0.24
104 0.28