Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0V0R1

Protein Details
Accession A0A0L0V0R1    Localization Confidence High Confidence Score 16.7
NoLS Segment(s)
PositionSequenceProtein Nature
236-285MEEAAKKKKKATKKTAPKAKQNLKTKKTPSKKQMNKAKKRVEEARRLAEEHydrophilic
NLS Segment(s)
PositionSequence
183-229REKMAKAKAEARRRKEEEEKKKEEDENKKKEEDEKKKKEEEEKKARE
239-298AAKKKKKATKKTAPKAKQNLKTKKTPSKKQMNKAKKRVEEARRLAEEAEKRAEEARKKAE
Subcellular Location(s) nucl 18, mito 6, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR029466  NAM-associated_C  
Pfam View protein in Pfam  
PF14303  NAM-associated  
Amino Acid Sequences MNKFYSCAKQIRYAKQSGVNSSKNLASAFKLHAAMNKCQEYGHIQCYRVLAPAQKWRDYCKKLEQKQLANLKKLTLSSDITALDAASDSTVVPPTRSAESNWPTGNKAAKEAHTQEMKDSKWKRDLVKVHRNLANQSQAQTNILDKQKKAIISLANSAVMKIDLDLVPAAQHEFLEWEQEKVREKMAKAKAEARRRKEEEEKKKEEDENKKKEEDEKKKKEEEEKKAREELEQIEMEEAAKKKKKATKKTAPKAKQNLKTKKTPSKKQMNKAKKRVEEARRLAEEAEKRAEEARKKAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.64
3 0.65
4 0.63
5 0.63
6 0.57
7 0.52
8 0.5
9 0.46
10 0.4
11 0.36
12 0.28
13 0.22
14 0.22
15 0.23
16 0.24
17 0.25
18 0.24
19 0.28
20 0.32
21 0.35
22 0.39
23 0.38
24 0.35
25 0.33
26 0.34
27 0.35
28 0.35
29 0.37
30 0.34
31 0.33
32 0.35
33 0.37
34 0.36
35 0.32
36 0.29
37 0.26
38 0.27
39 0.35
40 0.39
41 0.42
42 0.43
43 0.48
44 0.56
45 0.56
46 0.56
47 0.58
48 0.63
49 0.65
50 0.74
51 0.75
52 0.71
53 0.75
54 0.79
55 0.75
56 0.7
57 0.63
58 0.54
59 0.48
60 0.42
61 0.35
62 0.29
63 0.24
64 0.19
65 0.21
66 0.19
67 0.17
68 0.16
69 0.13
70 0.09
71 0.07
72 0.06
73 0.04
74 0.04
75 0.04
76 0.05
77 0.08
78 0.08
79 0.08
80 0.09
81 0.12
82 0.14
83 0.15
84 0.17
85 0.23
86 0.26
87 0.3
88 0.31
89 0.3
90 0.29
91 0.31
92 0.33
93 0.25
94 0.26
95 0.24
96 0.25
97 0.29
98 0.31
99 0.34
100 0.32
101 0.32
102 0.31
103 0.33
104 0.31
105 0.35
106 0.35
107 0.35
108 0.38
109 0.43
110 0.42
111 0.46
112 0.54
113 0.55
114 0.62
115 0.62
116 0.61
117 0.61
118 0.59
119 0.54
120 0.49
121 0.45
122 0.35
123 0.31
124 0.26
125 0.22
126 0.22
127 0.2
128 0.16
129 0.16
130 0.2
131 0.21
132 0.2
133 0.22
134 0.23
135 0.23
136 0.23
137 0.21
138 0.18
139 0.18
140 0.2
141 0.18
142 0.17
143 0.17
144 0.16
145 0.13
146 0.1
147 0.08
148 0.06
149 0.07
150 0.05
151 0.05
152 0.05
153 0.05
154 0.05
155 0.06
156 0.06
157 0.04
158 0.04
159 0.04
160 0.06
161 0.06
162 0.11
163 0.11
164 0.12
165 0.14
166 0.16
167 0.2
168 0.19
169 0.23
170 0.21
171 0.22
172 0.3
173 0.36
174 0.39
175 0.38
176 0.45
177 0.5
178 0.57
179 0.64
180 0.62
181 0.65
182 0.64
183 0.68
184 0.71
185 0.73
186 0.74
187 0.76
188 0.76
189 0.7
190 0.7
191 0.69
192 0.68
193 0.68
194 0.67
195 0.66
196 0.64
197 0.62
198 0.59
199 0.62
200 0.64
201 0.64
202 0.64
203 0.65
204 0.69
205 0.73
206 0.77
207 0.78
208 0.77
209 0.77
210 0.77
211 0.75
212 0.72
213 0.71
214 0.66
215 0.58
216 0.51
217 0.43
218 0.38
219 0.31
220 0.26
221 0.22
222 0.21
223 0.2
224 0.2
225 0.19
226 0.21
227 0.27
228 0.28
229 0.35
230 0.44
231 0.54
232 0.6
233 0.69
234 0.72
235 0.78
236 0.87
237 0.91
238 0.92
239 0.92
240 0.92
241 0.91
242 0.89
243 0.89
244 0.89
245 0.84
246 0.85
247 0.85
248 0.85
249 0.85
250 0.86
251 0.85
252 0.86
253 0.89
254 0.9
255 0.91
256 0.91
257 0.92
258 0.92
259 0.92
260 0.88
261 0.87
262 0.87
263 0.86
264 0.85
265 0.82
266 0.81
267 0.74
268 0.68
269 0.6
270 0.58
271 0.53
272 0.47
273 0.46
274 0.36
275 0.34
276 0.39
277 0.45
278 0.44