Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0V6U7

Protein Details
Accession A0A0L0V6U7   
Localization Confidence Low
Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
63-89HSQCLHKLQRKTKPPGRPCYQKNEKAFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, cyto_nucl 10.5, mito 9, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MPGSERSIGRTITGTVNCDGDSTGGWGSRGTLKRSRKETLAADSCSPSVEVRYQWVSEVSVYHSQCLHKLQRKTKPPGRPCYQKNEKAFASPLSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.22
3 0.23
4 0.21
5 0.2
6 0.18
7 0.12
8 0.1
9 0.1
10 0.1
11 0.09
12 0.09
13 0.09
14 0.1
15 0.17
16 0.2
17 0.23
18 0.3
19 0.37
20 0.44
21 0.5
22 0.51
23 0.46
24 0.48
25 0.46
26 0.47
27 0.45
28 0.39
29 0.35
30 0.32
31 0.3
32 0.25
33 0.22
34 0.14
35 0.09
36 0.09
37 0.08
38 0.1
39 0.12
40 0.12
41 0.12
42 0.12
43 0.12
44 0.11
45 0.11
46 0.12
47 0.17
48 0.17
49 0.18
50 0.19
51 0.19
52 0.21
53 0.26
54 0.31
55 0.33
56 0.42
57 0.5
58 0.58
59 0.67
60 0.75
61 0.78
62 0.79
63 0.81
64 0.83
65 0.83
66 0.84
67 0.79
68 0.8
69 0.82
70 0.8
71 0.78
72 0.75
73 0.68
74 0.62
75 0.59