Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0UZF2

Protein Details
Accession A0A0L0UZF2   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
60-86GSVRFTKSTRTKKRSKGIWKINRIYCLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto 8, mito 3
Family & Domain DBs
Amino Acid Sequences MSLPPESPPELVKWELPTNLESFLTFIDHGCTLDPQNYPIYPNDETVFVKFPDETVTNFGSVRFTKSTRTKKRSKGIWKINRIYCLRALPICKVIPSAKARRDVALAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.28
3 0.28
4 0.27
5 0.24
6 0.23
7 0.21
8 0.16
9 0.13
10 0.12
11 0.12
12 0.1
13 0.09
14 0.1
15 0.1
16 0.1
17 0.1
18 0.11
19 0.1
20 0.13
21 0.14
22 0.13
23 0.15
24 0.15
25 0.16
26 0.16
27 0.2
28 0.18
29 0.19
30 0.18
31 0.17
32 0.18
33 0.18
34 0.18
35 0.14
36 0.13
37 0.11
38 0.11
39 0.11
40 0.12
41 0.11
42 0.12
43 0.13
44 0.13
45 0.13
46 0.13
47 0.13
48 0.12
49 0.15
50 0.14
51 0.14
52 0.21
53 0.31
54 0.42
55 0.5
56 0.58
57 0.63
58 0.7
59 0.79
60 0.81
61 0.82
62 0.82
63 0.83
64 0.85
65 0.86
66 0.85
67 0.81
68 0.79
69 0.7
70 0.63
71 0.55
72 0.49
73 0.42
74 0.37
75 0.36
76 0.31
77 0.35
78 0.32
79 0.29
80 0.29
81 0.28
82 0.31
83 0.37
84 0.43
85 0.43
86 0.5
87 0.51
88 0.5