Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0V8U9

Protein Details
Accession A0A0L0V8U9   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
75-102VDRSSKKVPRSTKPKKSGKKSGKKSGSPBasic
NLS Segment(s)
PositionSequence
79-106SKKVPRSTKPKKSGKKSGKKSGSPQVHR
Subcellular Location(s) extr 24, plas 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR021851  DUF3455  
Pfam View protein in Pfam  
PF11937  DUF3455  
Amino Acid Sequences MISTLNVRFLVLQIFLVTGAWCAFNLDNVPSPLQSPRAAGLRLKYLTLGFGTQNYECQAGKWTFVGAEARLTDEVDRSSKKVPRSTKPKKSGKKSGKKSGSPQVHRNRRTMGHHYFVGKSPTFEITNVGKVTAGKPLVAPSSDPANVAWLQLAVLEGTFAKRVYRTSTSKGALSGPCKGSDTNKVPYSATYSFWG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.09
4 0.09
5 0.07
6 0.07
7 0.07
8 0.07
9 0.09
10 0.09
11 0.1
12 0.12
13 0.13
14 0.16
15 0.18
16 0.19
17 0.17
18 0.19
19 0.19
20 0.21
21 0.2
22 0.17
23 0.19
24 0.22
25 0.23
26 0.24
27 0.24
28 0.28
29 0.28
30 0.26
31 0.24
32 0.2
33 0.2
34 0.18
35 0.17
36 0.11
37 0.12
38 0.14
39 0.13
40 0.15
41 0.15
42 0.16
43 0.14
44 0.14
45 0.18
46 0.16
47 0.16
48 0.15
49 0.14
50 0.12
51 0.14
52 0.15
53 0.09
54 0.11
55 0.1
56 0.11
57 0.11
58 0.11
59 0.1
60 0.09
61 0.1
62 0.12
63 0.13
64 0.13
65 0.18
66 0.22
67 0.26
68 0.33
69 0.38
70 0.45
71 0.55
72 0.64
73 0.69
74 0.75
75 0.81
76 0.83
77 0.85
78 0.86
79 0.86
80 0.86
81 0.84
82 0.85
83 0.83
84 0.77
85 0.74
86 0.73
87 0.71
88 0.66
89 0.67
90 0.67
91 0.68
92 0.67
93 0.64
94 0.59
95 0.54
96 0.55
97 0.53
98 0.48
99 0.42
100 0.41
101 0.4
102 0.38
103 0.35
104 0.34
105 0.26
106 0.22
107 0.19
108 0.2
109 0.18
110 0.17
111 0.19
112 0.16
113 0.2
114 0.19
115 0.18
116 0.15
117 0.15
118 0.16
119 0.17
120 0.15
121 0.12
122 0.12
123 0.14
124 0.15
125 0.14
126 0.14
127 0.11
128 0.16
129 0.16
130 0.16
131 0.14
132 0.16
133 0.15
134 0.15
135 0.13
136 0.09
137 0.08
138 0.08
139 0.08
140 0.05
141 0.04
142 0.04
143 0.04
144 0.06
145 0.07
146 0.07
147 0.08
148 0.09
149 0.12
150 0.18
151 0.25
152 0.3
153 0.35
154 0.42
155 0.44
156 0.44
157 0.43
158 0.42
159 0.4
160 0.38
161 0.39
162 0.33
163 0.33
164 0.33
165 0.33
166 0.33
167 0.38
168 0.4
169 0.41
170 0.43
171 0.43
172 0.42
173 0.42
174 0.44
175 0.36