Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0V4H6

Protein Details
Accession A0A0L0V4H6   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
4-32SINPVKPAEPKEKKQQKQNVTVEERNKKVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto_nucl 14, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR040184  Mcm10  
IPR012340  NA-bd_OB-fold  
IPR015408  Znf_Mcm10/DnaG  
Gene Ontology GO:0005634  C:nucleus  
GO:0003690  F:double-stranded DNA binding  
GO:0003697  F:single-stranded DNA binding  
GO:0006270  P:DNA replication initiation  
Pfam View protein in Pfam  
PF09329  zf-primase  
Amino Acid Sequences MISSINPVKPAEPKEKKQQKQNVTVEERNKKVLPRKEAEKSNLAEGFRELRKESKNQSLIQASKRSTSFAAPAERRPIEEQPELRGSDLTIKLQIRRGPIDFKPSSIDPTFTEHEPNSETRLKRRTLAHHTLQDYLADRYVVRINELYAIIRKVEGNGFQSGNDWNVPLIGDWVLFGVIGQKSDFKNTTPYIASQVNRLTTQPQSHTPSKSKKLVDKDNDQEVVDELNEELARDDQAKQPKEEEVKKPQPKKFVTFKLIDMSSNKISSSGSGVIKMILFESDSQSSSSGGGGEGEKSYRGGSGGAYEKYWKEQPGTLIGILNPKVLKNRPSSYSRGPTTSPIEMLTITPENHQSIIVIGRSKDLGSCVAKRIDTGTLCNDWCDLRNSTINGNSHEAICDFHLQRQIKKVRANRAEFFSGTSGMLHMGSPNGPQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.73
3 0.77
4 0.81
5 0.84
6 0.83
7 0.84
8 0.86
9 0.85
10 0.83
11 0.83
12 0.83
13 0.82
14 0.75
15 0.7
16 0.64
17 0.61
18 0.62
19 0.63
20 0.63
21 0.62
22 0.67
23 0.7
24 0.76
25 0.75
26 0.73
27 0.66
28 0.63
29 0.6
30 0.51
31 0.43
32 0.37
33 0.37
34 0.32
35 0.33
36 0.28
37 0.31
38 0.36
39 0.42
40 0.46
41 0.5
42 0.54
43 0.53
44 0.58
45 0.59
46 0.59
47 0.59
48 0.6
49 0.51
50 0.5
51 0.48
52 0.44
53 0.37
54 0.34
55 0.31
56 0.29
57 0.37
58 0.35
59 0.39
60 0.45
61 0.44
62 0.44
63 0.45
64 0.44
65 0.41
66 0.45
67 0.42
68 0.4
69 0.44
70 0.41
71 0.37
72 0.32
73 0.26
74 0.27
75 0.27
76 0.23
77 0.24
78 0.25
79 0.27
80 0.32
81 0.35
82 0.32
83 0.34
84 0.35
85 0.36
86 0.36
87 0.43
88 0.38
89 0.37
90 0.37
91 0.33
92 0.36
93 0.31
94 0.3
95 0.22
96 0.27
97 0.29
98 0.25
99 0.28
100 0.22
101 0.23
102 0.24
103 0.24
104 0.24
105 0.28
106 0.29
107 0.33
108 0.39
109 0.39
110 0.42
111 0.47
112 0.51
113 0.54
114 0.6
115 0.6
116 0.61
117 0.61
118 0.57
119 0.51
120 0.44
121 0.36
122 0.28
123 0.21
124 0.15
125 0.12
126 0.12
127 0.16
128 0.14
129 0.14
130 0.13
131 0.13
132 0.15
133 0.15
134 0.14
135 0.12
136 0.13
137 0.12
138 0.12
139 0.12
140 0.11
141 0.12
142 0.13
143 0.14
144 0.16
145 0.16
146 0.15
147 0.17
148 0.16
149 0.15
150 0.13
151 0.11
152 0.08
153 0.08
154 0.08
155 0.06
156 0.07
157 0.05
158 0.05
159 0.05
160 0.05
161 0.05
162 0.04
163 0.04
164 0.07
165 0.07
166 0.07
167 0.08
168 0.11
169 0.11
170 0.15
171 0.16
172 0.13
173 0.18
174 0.18
175 0.21
176 0.19
177 0.19
178 0.2
179 0.24
180 0.23
181 0.21
182 0.22
183 0.21
184 0.2
185 0.2
186 0.19
187 0.17
188 0.2
189 0.19
190 0.23
191 0.27
192 0.31
193 0.35
194 0.39
195 0.44
196 0.47
197 0.52
198 0.5
199 0.5
200 0.54
201 0.59
202 0.58
203 0.57
204 0.56
205 0.53
206 0.51
207 0.45
208 0.37
209 0.28
210 0.23
211 0.15
212 0.11
213 0.06
214 0.06
215 0.05
216 0.05
217 0.05
218 0.05
219 0.05
220 0.06
221 0.08
222 0.12
223 0.2
224 0.21
225 0.22
226 0.23
227 0.27
228 0.33
229 0.38
230 0.4
231 0.43
232 0.52
233 0.6
234 0.67
235 0.66
236 0.69
237 0.66
238 0.67
239 0.65
240 0.63
241 0.6
242 0.54
243 0.52
244 0.48
245 0.44
246 0.39
247 0.31
248 0.28
249 0.24
250 0.22
251 0.2
252 0.15
253 0.14
254 0.13
255 0.15
256 0.15
257 0.13
258 0.14
259 0.14
260 0.14
261 0.14
262 0.13
263 0.1
264 0.06
265 0.06
266 0.06
267 0.09
268 0.1
269 0.1
270 0.11
271 0.11
272 0.11
273 0.11
274 0.1
275 0.08
276 0.07
277 0.07
278 0.07
279 0.07
280 0.08
281 0.08
282 0.08
283 0.08
284 0.08
285 0.08
286 0.08
287 0.07
288 0.07
289 0.11
290 0.15
291 0.15
292 0.16
293 0.18
294 0.18
295 0.21
296 0.24
297 0.21
298 0.19
299 0.21
300 0.23
301 0.26
302 0.27
303 0.24
304 0.23
305 0.22
306 0.24
307 0.22
308 0.22
309 0.18
310 0.17
311 0.22
312 0.25
313 0.3
314 0.32
315 0.37
316 0.4
317 0.44
318 0.5
319 0.53
320 0.58
321 0.55
322 0.51
323 0.48
324 0.47
325 0.47
326 0.42
327 0.34
328 0.26
329 0.24
330 0.21
331 0.2
332 0.19
333 0.17
334 0.15
335 0.16
336 0.18
337 0.18
338 0.18
339 0.18
340 0.14
341 0.13
342 0.15
343 0.16
344 0.16
345 0.15
346 0.16
347 0.17
348 0.17
349 0.16
350 0.15
351 0.18
352 0.2
353 0.23
354 0.26
355 0.29
356 0.29
357 0.29
358 0.3
359 0.3
360 0.27
361 0.28
362 0.28
363 0.29
364 0.29
365 0.29
366 0.28
367 0.23
368 0.24
369 0.25
370 0.23
371 0.23
372 0.28
373 0.29
374 0.32
375 0.37
376 0.38
377 0.37
378 0.39
379 0.36
380 0.31
381 0.3
382 0.26
383 0.21
384 0.2
385 0.24
386 0.21
387 0.24
388 0.32
389 0.35
390 0.39
391 0.48
392 0.54
393 0.53
394 0.61
395 0.65
396 0.67
397 0.74
398 0.77
399 0.73
400 0.71
401 0.69
402 0.6
403 0.56
404 0.47
405 0.39
406 0.31
407 0.26
408 0.19
409 0.15
410 0.15
411 0.12
412 0.1
413 0.1