Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0UY03

Protein Details
Accession A0A0L0UY03   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
184-213GLRLGRFSPERREKKKKSRFRLQVRNFLKFHydrophilic
NLS Segment(s)
PositionSequence
192-204PERREKKKKSRFR
Subcellular Location(s) nucl 16.5, mito_nucl 11.666, cyto_nucl 10.833, mito 5.5, cyto 3
Family & Domain DBs
Amino Acid Sequences MDTQSSKLSCFQDNGKPPTDRRRLNIPFSNILPKSTSPLCRSIYSLTQTLLDLNLKIPSEEWKLGPSLEKLNTVSSLPDSILLHPLDSIPRTALNSASEKIPPIHRLIFLEDLELSNFPGWTFAWDQPWESRWNQLLSRFILKHWQHALQAGSFKSFHMDPSESSDPIIQSGIIHCWLFGQEEGLRLGRFSPERREKKKKSRFRLQVRNFLKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.51
3 0.52
4 0.54
5 0.62
6 0.66
7 0.62
8 0.58
9 0.64
10 0.64
11 0.68
12 0.71
13 0.66
14 0.61
15 0.59
16 0.63
17 0.53
18 0.47
19 0.41
20 0.34
21 0.33
22 0.34
23 0.37
24 0.31
25 0.37
26 0.38
27 0.37
28 0.39
29 0.38
30 0.38
31 0.35
32 0.33
33 0.28
34 0.25
35 0.24
36 0.22
37 0.19
38 0.15
39 0.11
40 0.1
41 0.12
42 0.11
43 0.11
44 0.11
45 0.14
46 0.18
47 0.19
48 0.19
49 0.18
50 0.19
51 0.19
52 0.21
53 0.18
54 0.18
55 0.18
56 0.2
57 0.2
58 0.2
59 0.2
60 0.18
61 0.17
62 0.12
63 0.12
64 0.09
65 0.11
66 0.1
67 0.1
68 0.13
69 0.13
70 0.12
71 0.11
72 0.11
73 0.11
74 0.1
75 0.1
76 0.07
77 0.08
78 0.09
79 0.09
80 0.1
81 0.11
82 0.12
83 0.13
84 0.13
85 0.13
86 0.13
87 0.14
88 0.15
89 0.15
90 0.15
91 0.16
92 0.16
93 0.16
94 0.18
95 0.19
96 0.16
97 0.15
98 0.13
99 0.11
100 0.11
101 0.1
102 0.08
103 0.06
104 0.06
105 0.05
106 0.05
107 0.05
108 0.07
109 0.1
110 0.11
111 0.14
112 0.15
113 0.16
114 0.17
115 0.19
116 0.2
117 0.18
118 0.21
119 0.21
120 0.23
121 0.24
122 0.26
123 0.28
124 0.27
125 0.32
126 0.28
127 0.26
128 0.33
129 0.32
130 0.35
131 0.34
132 0.34
133 0.29
134 0.32
135 0.33
136 0.25
137 0.28
138 0.22
139 0.21
140 0.18
141 0.17
142 0.17
143 0.16
144 0.15
145 0.16
146 0.17
147 0.15
148 0.24
149 0.27
150 0.24
151 0.25
152 0.25
153 0.21
154 0.2
155 0.2
156 0.11
157 0.08
158 0.1
159 0.11
160 0.12
161 0.11
162 0.1
163 0.1
164 0.11
165 0.12
166 0.11
167 0.12
168 0.11
169 0.13
170 0.15
171 0.17
172 0.16
173 0.15
174 0.16
175 0.18
176 0.22
177 0.24
178 0.33
179 0.42
180 0.53
181 0.63
182 0.73
183 0.78
184 0.85
185 0.92
186 0.92
187 0.92
188 0.92
189 0.93
190 0.93
191 0.94
192 0.92
193 0.92